SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000012658 from Otolemur garnettii 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000012658
Domain Number 1 Region: 117-497
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 2.62e-101
Family Phosphonoacetate hydrolase 0.02
Further Details:      
 
Domain Number 2 Region: 590-832
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 5.71e-25
Family DNA/RNA non-specific endonuclease 0.0084
Further Details:      
 
Domain Number 3 Region: 25-70
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000112
Family Somatomedin B domain 0.002
Further Details:      
 
Domain Number 4 Region: 71-111
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000562
Family Somatomedin B domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000012658   Gene: ENSOGAG00000014125   Transcript: ENSOGAT00000014134
Sequence length 845
Comment pep:novel scaffold:OtoGar3:GL873521.1:26149822:26186002:1 gene:ENSOGAG00000014125 transcript:ENSOGAT00000014134 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLSVCVLTTILGCIFGLKPSCAKEVKSCKGRCFERTFGSCRCDVACVEMGNCCLDYQEAC
IEPDHIWTCNKFRCGEKRLLTSHCACSDDCKDQGDCCINYSSVCQGEQSWLEEPCGYIHV
PQCPAGFEVPPTLLFSLDGFRAEYLHTWGGLLPVISKLKDCGTYTKNMRPVYPTKTFPNH
YSIVTGLYPESHGIIDNKMYDPQMNASFSLKSKEKFNSAWYKGEPIWVTAKFQGLRSGTF
FWPGSDTPIHGVFPDIYQVYNGSVPFEERILAILQWLQLPEDQRPHFYTLYLEEPDSSGH
SHGPVSSEVIKALQRVDKMVGMLMDGLKELNLHKCLNIILISDHGMEQGSCKKYVYLNKY
LGDVKNIKVIYGPAARLRPADVPDKYYSFNYEGLAKNLSCREPNQHFKPYLKQFLPKRFH
FAKSERIEPLTFYLDPQWQLALNPSERKYCGNGFHGSDNAFANMQALFIGYGPGFKHGIE
VDTFENIEVYNLMCDLMNLTPSPNNGTHGSLNHLLKNPVYTPRHPKESYTPQYCPFTASP
RDNLSCSCNPSILPIEDFQKQFQVTATQEKIIKHEILPYGRPRILQKGDNICLLYQHRFV
SGYSEDFLMPLWTSYTVSRNDTFSTEDISNCLYQDFRVSLSPVHKCSFYKNNARVSYGFL
APPRLSKNSSQIYSEALLFTNIVPMYPSFQVIWHYFHDTLLRRYAKERNGVNVVSGPVFD
FDYDGLYDSSKTLRQNIKIIRSQEIMIPTHFFIVLTSCKNKSQVPLHCENLDPLAFILPH
RADNREGCAYGKHDSLWIEELLMLHRARIRDVELITGLSFYQERKEPVTDILKLKTHLPT
FSQEE
Download sequence
Identical sequences H0XAK5
ENSOGAP00000012658 ENSOGAP00000012658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]