SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000013203 from Otolemur garnettii 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000013203
Domain Number 1 Region: 148-307
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.09e-53
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000314
Further Details:      
 
Domain Number 2 Region: 52-145
Classification Level Classification E-value
Superfamily LCCL domain 2.88e-20
Family LCCL domain 0.0015
Further Details:      
 
Domain Number 3 Region: 1-44
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000785
Family Spermadhesin, CUB domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000013203   Gene: ENSOGAG00000014732   Transcript: ENSOGAT00000014739
Sequence length 633
Comment pep:novel scaffold:OtoGar3:GL873528.1:37181490:37216963:-1 gene:ENSOGAG00000014732 transcript:ENSOGAT00000014739 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGKYCGLGLRMNHSIESKSNEITVLFMSGIHISGRGFLASYSVIDKQGFISCISVEKHSL
VPFFSKYCPAGCLLPFAEISGTIPHGYRDSSPLCMAGVHAGVVSNILGGQISVVISKGIP
YYESSLANNITSVVGHLSTSLFTFKTSGCYGTLGMESGVIADPQITASSVLEWTDHTGQE
NSWKPEKARLKKPGPPWAALVTDEYQWLQVDLNKEKKITGIVTTGSTMVEHNYYVSAYKI
LYSDDGQKWTVYREPGVEQEKIFQGNRDYHQDVRNNFLPPIIARFIRVNPTQWQQKIAMK
MELLGCQFIPKGRPPKLTQPPPPRNSNDLKNTTAPPKIAKGRGPKFTQPLQPRSRHEFPA
QTEQTTATPDIKNTTVTPNVTKDVALAAVLVPVLVMVLTTLILISVCAWHWRNRKKKTEG
TYDLPYWDRAGWWKGMKQLLPAKSVEHEETPVRYSSSEVNHLSPREVTTVLQTDSAEYAQ
PLVGGIVGTLHQRSTFKPEEGKDAGYADLDPYNSPVQEVYHAYAEPLPISGPEYATPIVM
DMSGHPTASVGLPSTSTFKATGNQPPPLMGTYNTLLSRTDSCSSARAQYDTPKGGKPGPP
APDELVYQVPQSTQEALGAGRDGEGDAAFHKAS
Download sequence
Identical sequences H0XBU6
ENSOGAP00000013203 ENSOGAP00000013203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]