SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000013603 from Otolemur garnettii 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000013603
Domain Number 1 Region: 28-334
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 1.19e-96
Family (Glycosyl)asparaginase 0.00000000025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000013603   Gene: ENSOGAG00000015190   Transcript: ENSOGAT00000015195
Sequence length 346
Comment pep:novel scaffold:OtoGar3:GL873580.1:7499727:7511131:1 gene:ENSOGAG00000015190 transcript:ENSOGAT00000015195 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARKSNFPLLLVPLLLGPALVRGQGLLPLVLNTWPFKNATEAAWRTLAYGGSALDAVESG
CAVCEREQCDSTVGFGGSPDELGETTLDALIIDGTTMDMGAVGDLRRIKNAIGVARKVLE
HTTHTLLVGESATKFAESMGFINEDLSTEASRALHSGWHARNCQPNYWRNVIPDPSKYCG
PYKPANILKQEDSPYKGTRNDHGHDTIGMVVIHKKGRTAAGTSTNGLKFKIHGRVGDSPV
PGSGAYADDSAGAAAATGDGDTLMRFLPSYQAVEYMRRGEDPTTACQKVISRIQKYDAKF
FGAIICANVGGNYGAACNKLPTFTQFSFMVYNPTKNQATEETVNCI
Download sequence
Identical sequences H0XCR8
ENSOGAP00000013603 ENSOGAP00000013603 XP_003792845.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]