SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000013991 from Otolemur garnettii 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000013991
Domain Number 1 Region: 318-477
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.47e-57
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000181
Further Details:      
 
Domain Number 2 Region: 156-316
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.13e-54
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000393
Further Details:      
 
Domain Number 3 Region: 119-158
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000547
Family EGF-type module 0.0061
Further Details:      
 
Domain Number 4 Region: 76-123
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000802
Family EGF-type module 0.016
Further Details:      
 
Domain Number 5 Region: 24-63
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000273
Family EGF-type module 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000013991   Gene: ENSOGAG00000015620   Transcript: ENSOGAT00000015623
Sequence length 480
Comment pep:novel scaffold:OtoGar3:GL873536.1:17754529:18183566:-1 gene:ENSOGAG00000015620 transcript:ENSOGAT00000015623 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRLVATWLLVGLSLGVPPFGKGDVCDPNPCEHGGVCLPGLGGASFSCDCPDGFTDPNCS
SVVEVASDEEEPTSSGPCLPNPCHNGGTCEISEAYRGDTFIGYVCKCPRGFNGIHCQHNI
NECEADPCKNGGICTDLVANYSCECPGEFMGRNCQYKCSGPLGIEGGIISNQQITASSTH
RALFGLQKWYPYYARLNKKGLINAWTAAENDRWPWIQINLQRKMRVTGVITQGAKRIGSP
EYIKSYKIAYSNDGKTWAMYKVKGTSEDMVFRGNVDNNTPYANSFTPPIKAQYVRLYPQV
CRRHCTLRMELLGCELSGCSEPLGMKSGHIQDYQITASSIFRTLNMDMFTWEPRKARLDK
QGKVNAWTSGHNDQSQWLQVDLLVPTKVTGIITQGAKDFGHVQFVGSYKLAYSNDGEHWT
VYQDEKQRKDKVFQGNFDNDTHRKNVIDPPIYARHIRILPWSWYGRITLRSELLGCTEEE
Download sequence
Identical sequences H0XDN7
ENSOGAP00000013991 XP_003786010.1.62490 ENSOGAP00000013991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]