SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000015003 from Otolemur garnettii 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000015003
Domain Number 1 Region: 123-281
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.79e-33
Family CBM11 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000015003   Gene: ENSOGAG00000016760   Transcript: ENSOGAT00000016764
Sequence length 281
Comment pep:novel scaffold:OtoGar3:GL873569.1:8212708:8227723:-1 gene:ENSOGAG00000016760 transcript:ENSOGAT00000016764 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFVHKLLTSTYILRKCPKPSIGLHPLAGIHFADYSSNSPQKPVAAPGKAFSQRKTQGGL
QEHHQQEVALDTISPEEKPEVSFDKAIRDEIKDHFWRLKDELVNHWIGPEGRPLHEVLLE
QAKVVWQFRGKEDLDKWIVTSDKTIGGRSEVFLKMGKNNQSALLYGTLSSEGPYDGDSRQ
SGYCAMISRVPRGAFERRKSYDWSQFNTLYLRVRGDGRPWMVNIKEDSDFIQRKNQMYSY
FMFTRGGPYWQEVKIPFSKFFFSNQGRVRDVQSQLLLDKVT
Download sequence
Identical sequences H0XG26
ENSOGAP00000015003 ENSOGAP00000015003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]