SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000015261 from Otolemur garnettii 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000015261
Domain Number 1 Region: 272-430
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.17e-58
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000172
Further Details:      
 
Domain Number 2 Region: 110-269
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.18e-48
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000753
Further Details:      
 
Domain Number 3 Region: 25-63
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000925
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 4 Region: 66-112
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000134
Family EGF-type module 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000015261   Gene: ENSOGAG00000017042   Transcript: ENSOGAT00000017046
Sequence length 430
Comment pep:novel scaffold:OtoGar3:GL873548.1:12365403:12378484:-1 gene:ENSOGAG00000017042 transcript:ENSOGAT00000017046 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGSRLLAALCCALLCASGLRAAPGDLCDSSPCLNGGTCMVGRDNASFHCFCLEGFTGLI
CNETEKNPCSPNPCHNGGECRVTGNERRGDVFTPYACICTQGYVGTHCDDRCATPVGMEG
GAIADSQISASSVHLGFMGLQRWGPELARLHRTGIVNAWTASNYDKNPWIQVNLLRKMWV
TGVVTQGASRAGTHEYLKTFKVAYSLDGHRFTVIQDTETLGDKVFMGNVDNNGLKYNLFK
TPVEAQYVRLLPVLCQRACTLRFELLGCELNGCSEPLGLKDNIILDKQVKASSTYKTWGV
QAFSWYPFYARLDYQGKFNAWTAASNNASEWLQVDLGSQREVTGIITQGARDFGSIQYVA
SYKVAYSNDGMTWTEYKDPRTDKSKIFPGNSDNNSHKKNVFETPILARFVRILPVAWHNR
ITLRLELLGC
Download sequence
Identical sequences H0XGP6
ENSOGAP00000015261 ENSOGAP00000015261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]