SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000015478 from Otolemur garnettii 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000015478
Domain Number 1 Region: 154-525
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 1.96e-93
Family Phosphonoacetate hydrolase 0.038
Further Details:      
 
Domain Number 2 Region: 620-857
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 1.59e-21
Family DNA/RNA non-specific endonuclease 0.012
Further Details:      
 
Domain Number 3 Region: 54-102
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000405
Family Somatomedin B domain 0.0048
Further Details:      
 
Domain Number 4 Region: 103-144
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000759
Family Somatomedin B domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000015478   Gene: ENSOGAG00000014116   Transcript: ENSOGAT00000027073
Sequence length 879
Comment pep:novel scaffold:OtoGar3:GL873521.1:25957655:26042175:1 gene:ENSOGAG00000014116 transcript:ENSOGAT00000027073 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESTLTLSTEEPVKKNALKKYKIICVVLLALLVIVSLSLGLGLGLRKPEEQVSTGSCRKK
CFLASYRGLEGCRCDAGCKDRGDCCWDFEDTCVKSTQIWTCNKFRCGEARLESSLCSCSD
DCLQRKDCCVDYKSVCQGETPWVEESCDAAQESQCPKGFDLPPLILFSMDGFRAEYLHTW
GTLMPNINKLKTCGIHSKYMRAMYPTKTFPNHYTIVTGLYPESHGIIDNNMYDVNLNKNF
SLSSPEQKNPAWWHGQPMWLTAIYQGLKAATFFWPGSEVPINGTLPSKYVPYNRSVPYEK
RIFTILEWLDLPEAERPSFYTMYLEEPDSSGHDSGPVSAKVIKALQLVDDAFGMLMEGLK
QRNLHNCVNIILLADHGMDQTYCDKMEYMSDYFPKINFYMFEGPAPRIRARNIPHDFFSF
NSEEIVQNLSCRKPDQHFKPYLSPDLPKRLHYAKNVRIDKVHLLVDRQWLAVRYRSNSFC
GGGNHGYNNQFKSMEAFFIAHGPSFKKKTEIEPFENIEVYNLMCETDLLHIQPAPNNGTH
GSLNHLLKVPFYDPTHTEEVSKSSVCGFTTPLPTDPLDCLCPQLQNNSQLEQVNQRLNLS
EEEITATMKVNLPFGRPRVVQKNVDYCLLYHGEYVSGFGKAMKMPMWSSYTFPQPGNTSP
LPPTVPDCLRADVRVAPSESQKCSIYLAEKNITHGFLYPPANSRTSDSQYDALITSNFVP
MYEEFKKMWDYFHHVLLIKYAAERNGINVVSGPIFDYNYDGHFDAANEITEHVVGTSVPI
PTHYFVVLTSCKNRSHTPENCPGWLDVLPFIIPHRLTNVESCPENKPEDLWVEERFKAHV
ARVRDVELLTGLDFYQEKLQPVSEILQLKTYLPTFETVI
Download sequence
Identical sequences H0XH88
ENSOGAP00000015478 ENSOGAP00000015478

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]