SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000017794 from Otolemur garnettii 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000017794
Domain Number 1 Region: 7-137
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 8.51e-23
Family APC10-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000017794   Gene: ENSOGAG00000033463   Transcript: ENSOGAT00000027601
Sequence length 138
Comment pep:novel scaffold:OtoGar3:GL873624.1:4370036:4371195:-1 gene:ENSOGAG00000033463 transcript:ENSOGAT00000027601 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTHSLVCPETVSRVSSVLNRNTRQFGKKHLFDQDEETCWNSDQGPSQWVILEFPQRVCVS
QLQIQFQGGFSSRHCCLEGSQGNEALSKIVDFYPEDSNSLQTFSVPAAEVDRLKVTFEDA
TDFFGRVVIYHLRVLGKK
Download sequence
Identical sequences H0XNV3
ENSOGAP00000017794 ENSOGAP00000017794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]