SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000018727 from Otolemur garnettii 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000018727
Domain Number 1 Region: 112-259
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000000000111
Family CBM11 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000018727   Gene: ENSOGAG00000025312   Transcript: ENSOGAT00000031048
Sequence length 277
Comment pep:novel scaffold:OtoGar3:GL873521.1:42938259:42939178:1 gene:ENSOGAG00000025312 transcript:ENSOGAT00000031048 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLVHKLLNGIYILRKCPKLHTALYPFSGFHFADYCSGSLQKPVTAFGKASPQRKTEGSF
QGHHQKEASLNVTSLEERLDISFHKAIKDEVKGHLKGLEDCPLHEVLLEQAEFYEKEDLD
KWTVTSYKSKGGRSEIFLKMDKNNQSALLCETLSFKMPQDGNSKQPFKRKRYYDWSIYPC
LWDGWSWMMNIRKEVSHVLLLHVYLVVVGPYWQEVTIPFSKFFFPNEGRVWDVQCQLLLD
KISSIGSTLADKSGPFFLETDFIEVVSNPAHTEEFAH
Download sequence
Identical sequences H0XRI5
ENSOGAP00000018727 ENSOGAP00000018727

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]