SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000020718 from Otolemur garnettii 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000020718
Domain Number 1 Region: 2-218
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 3.46e-33
Family Proteasome subunits 0.000000666
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000020718   Gene: ENSOGAG00000033967   Transcript: ENSOGAT00000031217
Sequence length 231
Comment pep:novel scaffold:OtoGar3:GL873538.1:2106215:2107165:1 gene:ENSOGAG00000033967 transcript:ENSOGAT00000031217 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TSYDNHITVFSPEGHPFQVEYREAIKKGLTAVGARGKDIVVLGVEKKSVARLQEDQCLDA
NVCMAFAGLTADARTVIRGSQSHRLTVEDPVTVDTSLATSPVCSSLMRRAMVRPPWGISA
HTAGFNVGDTQDSIRLIIGTYQAWKANATGQSVQFLEKHYADGAIETRGPTKLVIKSLPE
VVQSGGKHRELAVVRGDQPLRSLNPEEIENYVAEIEKEKEEKEKKKQKKAS
Download sequence
Identical sequences H0XX75
ENSOGAP00000020718 ENSOGAP00000020718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]