SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000001370 from Otolemur garnettii 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000001370
Domain Number 1 Region: 400-513,633-770
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 4.15e-68
Family Phosphate binding protein-like 0.000000149
Further Details:      
 
Domain Number 2 Region: 4-378
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 6.73e-43
Family L-arabinose binding protein-like 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000001370   Gene: ENSOGAG00000001541   Transcript: ENSOGAT00000001541
Sequence length 940
Comment pep:novel scaffold:OtoGar3:GL873627.1:3780431:4088662:-1 gene:ENSOGAG00000001541 transcript:ENSOGAT00000001541 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVACSPHSLRIAAILDDPMECSRGERLSITLAKNRINRAPERLGKAKVEVDIFELLRDSE
YETAETMCQILPKGVVAVLGPSSSPASSSIISNICGEKEVPHFKVAPEEFVKFQFQRFTT
LNLHPSNTDISVAVAGVLNFFNCTTACLICAKAECLLNLEKLLRQFLISKDTLSVRMLDD
TRDPTPLLKEIRDDKTATIIIHANASMSHTILLKAAELGMVSAYYTYIFTNLEFSLQRMD
SLMDDRVNILGFSIFNQSHAFFQEFAQSLNQSWQENCDHVPFTGPALSSALLFDAVYAVV
TAVQELNRSQEIGVKPLSCGSAQIWQHGTSLMNYLRMVELEGLTGHIEFNSKGQRSNYAL
KILQFTRNGFRQIGQWHVAEGLSMDSRLYASNISDSLFNTTLVVTTILENPYLMLKGNHQ
EMEGNDRYEGFCVDMLKELAEILRFNYKIRLVGDGVYGVPEANGTWTGMVGELIARKADL
AVAGLTITAEREKVIDFSKPFMTLGISILYRVHMGRKPGYFSFLDPFSPGVWLFMLLAYL
AVSCVLFLVARLTPYEWYSPHPCAQGRCNLLVNQYSLGNSLWFPVGGFMQQGSTIAPRAL
STRCVSGVWWAFTLIIISSYTANLAAFLTVQRMDVPIESVDDLADQTAIEYGTIHGGSSM
TFFQNSRYQTYQRMWNYMYSKQPSVFVKSTEEGIARVLNSNYAFLLESTMNEYYRQRNCN
LTQIGGLLDTKGYGIGMPVGSVFRDEFDLAILQLQENNRLEILKRKWWEGGKCPKEEDHR
AKGLGMENIGGIFVVLICGLIVAIFMAMLEFLWTLRHSEATEVSVCQEMVSELRSIVLCQ
DSIHPRRRRSGVPQPRPPGPEERRPRGTATLSNGKLCGAGEPDQLAQRLAQEAALVARGC
THIRVCPECRRFQGLRARPSPARSDESLEWDKTTNSSEPE
Download sequence
Identical sequences H0WIU0
ENSOGAP00000001370 ENSOGAP00000001370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]