SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000001533 from Otolemur garnettii 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000001533
Domain Number 1 Region: 123-308
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 4.87e-19
Family beta-CASP RNA-metabolising hydrolases 0.083
Further Details:      
 
Domain Number 2 Region: 14-117
Classification Level Classification E-value
Superfamily ISP domain 0.000000000000756
Family Ring hydroxylating alpha subunit ISP domain 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000001533   Gene: ENSOGAG00000001719   Transcript: ENSOGAT00000001720
Sequence length 600
Comment pep:novel scaffold:OtoGar3:GL873545.1:20630015:20690256:-1 gene:ENSOGAG00000001719 transcript:ENSOGAT00000001720 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QRAEILLCLSPLEVANLKEGINFFRNKSTGKDYILYKDRCHLRACKNMCKHQGGLFIKDI
EDLDGRSVRCTKHNWKLDVSTMKYINPPESFCQDELVVEMDECKGLLLLELNPPNPWDSE
PRSLEDLAFGEVQVTYLTHACMDLKLGDKRMVFDPWLIGPAFARGWWLLHEPPSDWLERL
CQADLIYISHMHSDHLSYPTLKKLAERRPDIPIYVGDTERPVFWNLNQSGVKLTNINVVP
FGVWQQVNKNLRFMILMDGVHPEMDTCIIVEYKGHKILNTVDCTRPNGGRLPMNVDLMMS
DFAGGASGFPMTFSGGKFTEEWKAQFIKTERKKLLNYKAQLVKDLQPRIYCPFAGYFVES
HPSDKYIKETNTKNDPHELNNLIKKKSDVVTWTPRPGAVLDLGRMLKDPTDSKGIIEPPV
GTKIYKDSWDFGPYLKILNASIGDEIFLHPSWIKEYFTWAGFKDYNLVVRMIETDDDFSP
FPGGYDYLVDFLDLSFPKERPHREHPYEEIRSRVDVIRHVVKNGLLWDDLYIGFQTRLQR
DPDIYHHLFWNHFQIKLPLTPPNWRSFLIHRKEHLIFYPQFSVKRANKPTRNRFSEENQT
Download sequence
Identical sequences H0WJ77
ENSOGAP00000001533 ENSOGAP00000001533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]