SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000001818 from Otolemur garnettii 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000001818
Domain Number 1 Region: 170-375
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.72e-54
Family DBL homology domain (DH-domain) 0.0000000056
Further Details:      
 
Domain Number 2 Region: 2-229
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.09e-46
Family Calponin-homology domain, CH-domain 0.0038
Further Details:      
 
Domain Number 3 Region: 380-542
Classification Level Classification E-value
Superfamily PH domain-like 3.28e-34
Family Pleckstrin-homology domain (PH domain) 0.0043
Further Details:      
 
Domain Number 4 Region: 633-753
Classification Level Classification E-value
Superfamily SH2 domain 2.49e-26
Family SH2 domain 0.00064
Further Details:      
 
Domain Number 5 Region: 780-839
Classification Level Classification E-value
Superfamily SH3-domain 3.81e-22
Family SH3-domain 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000001818   Gene: ENSOGAG00000002034   Transcript: ENSOGAT00000002039
Sequence length 845
Comment pep:novel scaffold:OtoGar3:GL873646.1:5581179:5645556:1 gene:ENSOGAG00000002034 transcript:ENSOGAT00000002039 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELWRQCTHWLIQCRVLPPSHRVTWEGAQVCELAQALRDGVLLCQLLNNLLPHAVNLREV
NLRPQMSQFLCLKNIRTFLSTCCEKFGLKRSELFEAFDLFDVQDFGKVIYTLSALSWTPI
AQNKGIMPFPTEEDSVGDEDIYSGLSDQIDDTVEEDEDLYDCVENEEAEGDEIYEDLMRS
EPVPMPPKMTEYDKRCCCLREIQQTEEKYTDTLGSIQQHFMKPLQRFLKPPDIEIIFINI
EDLLHVHIHFLKEMKEALATPGASTLYQVFIKYKERFLIYGRYCSQVESASKHLDRVAAT
REDVQMKLEECSQRANNGRFTLRDLLMVPMQRVLKYHLLLQELVKHTQDVMEKENLRLAL
DAMRDLAQCVNEVKRDNETLRQITNFQLSIENLDQSLAHYGRPKIDGELKITSVERRSKM
DRYAFLLDKALLICKRRGDSYDLKDFVNLHSFQVRDDSSGDRDNKKWSHMFLLIEDQGAQ
GYELFFKTRELKKKWMEQFEMAISNIYPENATANGHDFQMFSFEETTSCKACQMLLRGTF
YQGYRCHRCRAPAHKECLGRVPPCGRHGHDSSGTMKKDKPHRRAQDKKRNDLGLPRMEVF
QEYYGLPPPPGAFGPFVRLNPGDIVELTKAEAEQNWWEGRNTATNEVGWFPCNRVKPYVH
GPPQDLSVHLWYAGPMERAGAESILTNRSDGTFLVRQRVKDAAEFAISIKYNVEVKHIKI
MTAEGLYRITEKKAFRGLTELVEFYQQNSLKDCFKSLDTTLQFPFKEPERRAISKPPAGS
TKYFGTAKARYDFCARDRSELSLKEGDIIKILNKKGQQGWWRGEIYGRIGWFPSNYVEED
YSEYC
Download sequence
Identical sequences H0WJW9
ENSOGAP00000001818 ENSOGAP00000001818 XP_003798050.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]