SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000001874 from Otolemur garnettii 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000001874
Domain Number 1 Region: 2-196
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 8.55e-49
Family Proteasome subunits 0.00000000964
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000001874   Gene: ENSOGAG00000002097   Transcript: ENSOGAT00000002099
Sequence length 202
Comment pep:novel scaffold:OtoGar3:GL873544.1:21076787:21117512:1 gene:ENSOGAG00000002097 transcript:ENSOGAT00000002099 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEYLIGIQGPDYVLVASDRVAASSIVQMKDADHDKMFKMSEKILLLCVGEAGDTVQFAEY
IQKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMD
YLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRDKAVELLKKCLEELQKRFILNLPTFS
VRIIDKSGIHELDNISFPKHGS
Download sequence
Identical sequences H0WK12
ENSOGAP00000001874 ENSOGAP00000001874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]