SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000002838 from Otolemur garnettii 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000002838
Domain Number 1 Region: 159-472
Classification Level Classification E-value
Superfamily RNI-like 3.66e-47
Family Cyclin A/CDK2-associated p19, Skp2 0.0052
Further Details:      
 
Domain Number 2 Region: 97-147
Classification Level Classification E-value
Superfamily F-box domain 1.23e-17
Family F-box domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000002838   Gene: ENSOGAG00000003172   Transcript: ENSOGAT00000003174
Sequence length 481
Comment pep:novel scaffold:OtoGar3:GL873552.1:10262092:10549802:-1 gene:ENSOGAG00000003172 transcript:ENSOGAT00000003174 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPGKGSSSISSDVSSSTDHTPTKAQKNVATSEDSDLSMRTLSTPSPALICPPNLPGFQNG
RGSSTSSSSITGETVAMVHSPPPTRLTHPLIRLASRPQKEQASVDRLPDQCMVHVFSFLP
TNQLCRCARVCRRWYNLAWDPRLWRTIRLTGETINVDRALKVLTRRLCQDTPNVCLMLET
VTVSGCRRLTDRGLYTIAQCCPELRRLEVSGCYNISNEAVFDVVSLCPNLEHLDVSGCSK
VTCISLTREASIKLSPLHGKQISIRYLDMTDCFVLEDEGLHTIAAHCTQLTHLYLRRCVR
LTDEGLRYLVIYCTSIKELSVSDCRFVSDFGLREIAKLESRLRYLSIAHCGRVTDVGVRY
VAKYCSKLRYLNARGCEGITDHGVEYLAKNCTKLKSLDIGKCPLVSDTGLECLALNCFNL
KRLSLKSCESITGQGLRIVAANCSDLQMLNVQDCEVSVEALRFVKRHCKRCVIEHTNPAF
F
Download sequence
Identical sequences H0WM89
ENSOGAP00000002838 ENSOGAP00000002838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]