SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000003441 from Otolemur garnettii 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000003441
Domain Number 1 Region: 448-626
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.42e-50
Family SPRY domain 0.00044
Further Details:      
 
Domain Number 2 Region: 7-78
Classification Level Classification E-value
Superfamily RING/U-box 3.98e-19
Family RING finger domain, C3HC4 0.0073
Further Details:      
 
Domain Number 3 Region: 147-206
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000641
Family B-box zinc-binding domain 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000003441   Gene: ENSOGAG00000003870   Transcript: ENSOGAT00000003873
Sequence length 627
Comment pep:novel scaffold:OtoGar3:GL873613.1:1137707:1162931:-1 gene:ENSOGAG00000003870 transcript:ENSOGAT00000003873 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELYPLADELSCSICLEPFKEPVTTPCGHNFCGSCLNETWAGPGGPYLCPHCRAVYHSR
PQLRKNTVLCAVVEQFLQAELAREAPADEWTPPARAAAPTSGVWVACDHCLKEAAVKTCL
VCMASFCQEHLRPHLDSPAFQDHLLQPPVADLLRRKCPQHNRLREFFCPEHSVCICHICL
VEHKPCSPVSLSQASTDLETKLRHKVTVMYSQINGASRALDDVRARQQDIRAAMNKKVEQ
LKQEYKEMKALIEASEANATRKIKEEEKRVNAKFDTIYQALLKRKNEIQKLKEEIEAGLT
KGDELEFLEKATTTKAPATTPSYFFVAVWLGLSLNPPPSVYGAGTLPTEPQVKASKLQGD
SGEHGPAASTHKPLRPGKVPKDEKTTKKHPPAAPTGKTTKVPTFGAPEELVDFKQVDQEA
AAKASTPKPNSEALKATVLGNFLAKSRPELLEYHIKVILDYNTAHSKVALSENYSVASVA
DTPQSYRPHPQRFTSCSQVLGLHCYKKGIHYWEVEMQKNNFCGVGICYGSMERKGPESRL
GRNNASWCVEWFNTKISAWHNNVEKTLPSTKATRVGVLLNCDHGFIIFFAVADKVHLLYK
YKVDFTEAVYPGFWVFSAGATLTICNP
Download sequence
Identical sequences H0WNN0
ENSOGAP00000003441 ENSOGAP00000003441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]