SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000004080 from Otolemur garnettii 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000004080
Domain Number 1 Region: 374-646
Classification Level Classification E-value
Superfamily Kelch motif 3.14e-67
Family Kelch motif 0.000085
Further Details:      
 
Domain Number 2 Region: 82-209
Classification Level Classification E-value
Superfamily POZ domain 9.03e-27
Family BTB/POZ domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000004080   Gene: ENSOGAG00000004572   Transcript: ENSOGAT00000004576
Sequence length 653
Comment pep:novel scaffold:OtoGar3:GL873541.1:14775541:14831770:1 gene:ENSOGAG00000004572 transcript:ENSOGAT00000004576 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAQALYASPQPLAVSTLPGVGQVARPGPTAVGNGHMAGPLLPPPAQPSATVPSSAPATN
GPPTTDSAHGLQMLRTIGVGKYEFTDPGHPREMLKELNQQRRAKAFTDLKIVVEGREFEV
HQNVLASCSLYFKDLIQRSVQDGGQGGREKLELVLSNLQADVLELLLEFVYTGSLVIDSA
NAKTLLEAASKFQFHTFCKVCVSFLEKQLTASNCLGVLAMAEAMQCSELYHMAKAFALQI
FPEVAAQEEILSISKDDFIAYVSNDSLNTKAEELVYETVIKWIKKDPASRAQYAAELLAV
VRLPFIHPSYLLNVVDNEELIKSSEACRDLVNEAKRYHMLPHARQEMQTPRTRPRLSAGV
AEVIVLVGGRQMVGMTQRSLVAVTCWNPQNNKWYPLASLPFYDREFFSVVSAGDNIYLSG
GMESGVTLADVWCYMSLLDNWNLVSRMTVPRCRHNSLVYDGKIYTLGGLGVAGNVDHVER
YDTITNQWEAVAPLPKAVHSAAATVCGGKIYVFGGVNEAGRAAGVLQSYIPQTNTWSFIE
SPMIDNKYAPAVTLNGFVFILGGAYARATTIYDPDKGNIKAGPNMNHSRQFCSAVVLDGK
IYATGGIVSSEGPALGNMEAYEPTTNTWTLLPHMPCPVFRHGCVVIKKYIQSG
Download sequence
Identical sequences H0WQ68
ENSOGAP00000004080 ENSOGAP00000004080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]