SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000004107 from Otolemur garnettii 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000004107
Domain Number 1 Region: 118-301
Classification Level Classification E-value
Superfamily PH domain-like 2e-55
Family Phosphotyrosine-binding domain (PTB) 0.000000206
Further Details:      
 
Domain Number 2 Region: 461-568
Classification Level Classification E-value
Superfamily SH2 domain 7.94e-28
Family SH2 domain 0.0000177
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000004107   Gene: ENSOGAG00000004603   Transcript: ENSOGAT00000004604
Sequence length 580
Comment pep:novel scaffold:OtoGar3:GL873548.1:13098976:13129650:-1 gene:ENSOGAG00000004603 transcript:ENSOGAT00000004604 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTQGPGGRAPPAPPEPEAPTTFCALLPRMPQWKFAAAGGFLGRSPAAARAAEAAEVGDPQ
PEPAGATSVPALAAAVLGACEPRCAVPCSLPALSRCRAAGRGPRGARGPAGPPDAAAAEW
IRKGSFIHKPAHGWLHPDARVLGPGVSYIVRYMGCIEVLRSMRSLDFNTRTQVTREAINR
LHEAVPGVRGSWKKKAPNKALASILGKSNLRFAGMSISINISIDGLNLSVPATRQVIASH
HMPSISFASGGDTDMTDYVAYVAKDPVNQRACHILECCEGLAQSVISTVGQAFELRFKQY
LHSPPTVVMPLDRLTGQEESAWGDEDEVSEHNYYNSIPGKEPPLGGLVDSRLALSQPCTL
GALGALGQGTSSARRDAHSLPWDLGSSGTATPGDGYVQADTRGPRVYEGHLYVNTQGLDA
PEPEDSPKKDLFDMRPFEDALKLHECSVAAGTTAVPLPLEDQWPSPPTRRAPVAPTEEQL
RQEPWYHGRMSRRAAERLLRADGDFLVRDSITNPGQYVLTGMHAGQPKHLLLVDPEGVVR
TKDVLFESISHLIDYHLQNGQPIVAAESELHLRGVVTREP
Download sequence
Identical sequences H0WQ91
ENSOGAP00000004107 ENSOGAP00000004107 XP_003788719.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]