SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000005257 from Otolemur garnettii 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000005257
Domain Number 1 Region: 117-211
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.45e-28
Family Ras-binding domain, RBD 0.00021
Further Details:      
 
Domain Number 2 Region: 433-546
Classification Level Classification E-value
Superfamily SH2 domain 4.17e-24
Family SH2 domain 0.00000142
Further Details:      
 
Domain Number 3 Region: 238-367
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000216
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000005257   Gene: ENSOGAG00000005877   Transcript: ENSOGAT00000005880
Sequence length 549
Comment pep:novel scaffold:OtoGar3:GL873642.1:839165:911398:1 gene:ENSOGAG00000005877 transcript:ENSOGAT00000005880 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YPEDDVDLEALVNDMNASLESLSSACSMQSDTVPLLQNGQHARSQPRTPSTRPLQPQASP
RQKVQRSQPVHILAVRRLQEEDQQFRTSSLPAIPNPFPELCGPGSSPVLAPSSLPPTQAA
AKQDVKVFSEDGTSKVVEILTDMTARDLCQLLVYKSHCVDDNSWTLVEHHPHLGLERCLE
DHELVVQVESTMASESKFLFRKNYAKYEFFKNPMNFFPEQMVTWCQQSNGSQTQLLQNFL
NSSSCPEIQGFLHVKELGKKSWKKLYVCLRRSGLYCSTKGTSKEPRHLQLLADLEDSNVF
SLIAGRKQYSAPTDHGLCIKPNKVRNEAKELRLLCAEDEQSRVCWITAFRLLKYGMLLYQ
NYRIPQQRKALLAPFSTPVRSVSENSLVAMDFSGQTGRVIENPAEAQSAALEEGHAWRKR
STRMNILSSQSPLHPSTLSTVIHRTQHWFHGRISREESHRIIKQQGLVDGLCLSRPARTN
SRLFHLTLCHHQKIKNFQILPCEDDGQMFFSLDDGNTKFSDLIQLVDFYQLNKGVLPCKL
KHHCIRVAL
Download sequence
Identical sequences H0WT12
ENSOGAP00000005257 ENSOGAP00000005257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]