SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000006064 from Otolemur garnettii 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000006064
Domain Number 1 Region: 287-375
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 1.11e-36
Family Small-conductance potassium channel 0.0000756
Further Details:      
 
Domain Number 2 Region: 189-333
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.03e-24
Family Voltage-gated potassium channels 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000006064   Gene: ENSOGAG00000006782   Transcript: ENSOGAT00000006782
Sequence length 427
Comment pep:novel scaffold:OtoGar3:GL873671.1:1206943:1217822:-1 gene:ENSOGAG00000006782 transcript:ENSOGAT00000006782 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGELVPGLGALRRRKRLLEQEKSLAGWALALAGIGIGLMVLHAEMLWFGGCPWAIYMFL
VKCMISTSTFLLLCLIVAFHAKEVQLFMTDNGLRDWRVALTGRQVAQIALELAVCGLHPA
PVRGLPCSQGSGAPLVATQPWPVFLGQGEALLSLAMLLRLYLVPRAVLLRSGVLLNASYR
SIGALNQVRFRHWFVAKLYMNTHPGRLLLGLTIGLWLTTAWVLSVAERQAVNATGHLSDT
LWLIPITFLTIGYGDVVPGTMWGKIVCLCTGVMGVCCTALLVAVVARKLEFNKAEKHVHN
FMMDIQYAKEMKESAARVLQEAWMFYKHTRRKDSGAARRHQRRLLAAINAFRQVRLKHRK
LQEQVNSMVDISKMHMILCDLQLGLSSSHRALEKRIDTLAGKLDTLTELLNTALGPQQLP
ETGQEAT
Download sequence
Identical sequences H0WUW1
XP_003799541.1.62490 ENSOGAP00000006064 ENSOGAP00000006064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]