SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000006083 from Otolemur garnettii 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000006083
Domain Number 1 Region: 6-302
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.38e-83
Family Eukaryotic proteases 0.00065
Further Details:      
 
Domain Number 2 Region: 323-424
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-17
Family Spermadhesin, CUB domain 0.0025
Further Details:      
 
Domain Number 3 Region: 436-469
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000458
Family Spermadhesin, CUB domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000006083   Gene: ENSOGAG00000006799   Transcript: ENSOGAT00000006803
Sequence length 469
Comment pep:novel scaffold:OtoGar3:GL873520.1:36433283:36447348:-1 gene:ENSOGAG00000006799 transcript:ENSOGAT00000006803 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSISRNKLILLLGMFCFEQGKSATLSLPKAPNCGQILTKAHPWSYFKIFSRILGGNQVEK
GSYPWQVSLKKKQKHVCGGTIISPQWVITAAHCVAYRSNMSTLNITAGEHDLSQEEPEEQ
TLPIESVIKHPHFSTKKPMDYDIALLKMAGAFQFGRFVGPICLPEPGERFEAGLTCTTAG
WGRLGEDGILPQVLQEVNLPILTQNECMEALSSLKQFISGNTFLCTGFPEGGKDACQGDS
GGSLMCRNEKGAWTLAGVTSWGLGCGRGWRNNMEQSYQSDQGSPGIFTDVSKLLPWILKH
IQTDKEAITQGLWKPGAEKDRVVSGSEGELHFTENLQLYYESKQLCVWTLLVPEEMHVLL
SFFHLDVETCHHNYLSIYSLEDRLIGNFYGESLTSSILVGSNSIRLELISDATNYATRFN
LTYKPLKPNYLPDSGCSFLTVLFEEGFIQSLNYPGNYSDVANCNWIFQA
Download sequence
Identical sequences H0WUX7
ENSOGAP00000006083 ENSOGAP00000006083

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]