SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000006859 from Otolemur garnettii 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000006859
Domain Number 1 Region: 504-561
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.35e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 2 Region: 364-421
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.97e-24
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 3 Region: 59-119
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.05e-22
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 4 Region: 420-477
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.64e-21
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 5 Region: 546-598
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.01e-19
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 6 Region: 280-337
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.59e-18
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 7 Region: 576-629
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.47e-16
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 8 Region: 242-294
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000012
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 9 Region: 327-359
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000436
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 10 Region: 468-499
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000133
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000006859   Gene: ENSOGAG00000007662   Transcript: ENSOGAT00000007666
Sequence length 631
Comment pep:novel scaffold:OtoGar3:GL873742.1:603538:612523:1 gene:ENSOGAG00000007662 transcript:ENSOGAT00000007666 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEVVLLDASPGPPSQLLWKPPDAQLLLERALPTPQYPACVKDGGQGNLLEADTTLITQA
QESMMFEDVAVKFTSREWQYLSYDQRHLYKDVMLENYGNMISLGFSFPKPHLISHLEQGA
EPCVQDLQDREFLSCSYPVSTDKTWPDNEKTSSEQEVFENRIINKVKFNSLLEVVSQDPE
VGEACLQGVKFENQWETPIMREEEGSSTELAFKIGKNPKILRKNFNPNSKHFPYNRVLIA
QKCHECAKCGKNFNWHSDLILHEQIHSREKPHVCNTCGKAFKTRNQLSMHQIIHIGKKPF
NCAQCGKAFNSRSALCRHKKTHSEDKPHACRDCGKTFKTRNRLCVHQLVHTGEKPFECND
CGKAFQFKHSLTIHVRIHTGEKPYECEQCGKAFSGSSDLTKHTRIHTGERPYKCSECGKA
FSQSSDLSKHKRIHTQEKHYGCPQCGKVFTIKAELTKHRKIHTEEKSYKCEECGKTFRHN
CKRRAHEREHTGEKPYQCGACGKAFQDQHCLTVHQRIHTGDKPYKCSECGKAFNGKSNLT
NHQRIHTGEKPYKCEVCGKAFPHSSVLRQHKRIHTGEKPYICCECGMSFRQGSALIGHKR
VHTGERPYECEECGKTFRVSSNLTGHKKRKH
Download sequence
Identical sequences H0WWT1
ENSOGAP00000006859 ENSOGAP00000006859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]