SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000007619 from Otolemur garnettii 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000007619
Domain Number 1 Region: 336-470,783-958
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 9.37e-53
Family Diacylglycerol kinase-like 0.013
Further Details:      
 
Domain Number 2 Region: 64-187
Classification Level Classification E-value
Superfamily PH domain-like 1.1e-29
Family Pleckstrin-homology domain (PH domain) 0.0034
Further Details:      
 
Domain Number 3 Region: 1162-1228
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1e-19
Family SAM (sterile alpha motif) domain 0.0035
Further Details:      
 
Domain Number 4 Region: 232-302
Classification Level Classification E-value
Superfamily Cysteine-rich domain 3.74e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000428
Further Details:      
 
Domain Number 5 Region: 171-228
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000434
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000007619   Gene: ENSOGAG00000008503   Transcript: ENSOGAT00000008510
Sequence length 1236
Comment pep:novel scaffold:OtoGar3:GL873562.1:137621:327455:1 gene:ENSOGAG00000008503 transcript:ENSOGAT00000008510 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGAGGQHHPPGAAGGATAGAGAVVTPAATSAGPGEDSSDSEAEQEGPQKLIRKVSTSGQ
IRTKTSIKEGQLLKQTSSFQRWKKRYFKLRGRTLYYAKDSKSLIFDEVDLSDASVAEAST
KNANNSFTIITPFRRLMLCAENRKEMEDWIGSLKSVQTRETYEVAQFNVEHFSGMHNWYA
CSHARPTFCNVCRESLSGVTSHGLSCEVCKFKAHKRCAVRATNNCKWTTLASVGKDIIED
EDGVAMPHQWLEGNLPVSAKCAVCDKTCGSVLRLQDWKCLWCKTMVHTACKDLYHPICPL
GQCKVSIIPPIALNSTDCDAGFCRVTYACGFSFCTSPLLVFVNSKSGDNQGVKFLRRFKQ
LLNPAQVFDLTNGGPHLGLRLFQEFDNFRILVCGGDGSVGWVLSEIDKLNLNKRCQVGVL
PLGTGNDLARVLGWGASYDDDTQLPQILEKLERASTKMLDRWSVMTYELKLPPKASLPPG
TPEASEELYFFQMTIYEDSVATHLTKIINSDERAVVISSAKTLCETVKDFVAKVEKSYDR
TLENAVVANAVANKCSVLNEKLEQLLQALHTDSQAVPVLSSTSPVIVEEYAVESSSEESL
GESREQLADDIRKSCSHKGVKPREIMLRANSLKKAVRQVIEEAEKVVDDQTVHPCEPASQ
SSDYDSIETDESKEELKDDESKESLTDSCGRFRPFKTAPRSPDSRTSHSHYQTDSGSGTA
VAASKENLPVLNTRIICPGLRAGLAASIAGSSIINKMLLANTDPFGATPFIDPDPDSVDG
YSEKCVMNNYFGIGLDAKISLEFNNKREEHPEKCRSRTKNLMWYGVLGTRELLQRSYKNL
EQRVQLECDGQYIPLPSLQGIAVLNIPSYAGGTNFWGGTKEDDIFTAPSFDDKILEIVAI
FDSVQMAMSRVIKLQHHRIAQCRTVKITIFGDEGLPVQVDGEAWVQPPGIIKIVHKNRAQ
MLTRDRAFENTLKSWEDKQKYDSGKPVIRTHLYIQHGMDLATEEVSQMQLCSQAAEELIT
RICDAATIHCLLEQELAHAVNACSHALNKANPRCAENLTRDAATEIAINVKALYNETESL
LDGRVPLQLESPHEERVSNALHSVEVELQKLTEIPWLYYILHPNQNAEPPMDCTKRNNRS
TVFRIVPKFKKEKVQKQKTGPQPVQKWGTEEVAAWLDLLNLGEYKDIFIHHDIRGAELLH
LKRRDLKDLGILKVGHMKRILQGIKELGRSTPQSEV
Download sequence
Identical sequences H0WYM4
ENSOGAP00000007619 ENSOGAP00000007619

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]