SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000008008 from Otolemur garnettii 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000008008
Domain Number 1 Region: 66-310,418-482
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.99e-40
Family FAD-linked reductases, N-terminal domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000008008   Gene: ENSOGAG00000008933   Transcript: ENSOGAT00000008935
Sequence length 488
Comment pep:novel scaffold:OtoGar3:GL873616.1:425711:434274:1 gene:ENSOGAG00000008933 transcript:ENSOGAT00000008935 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRRMLRLGWGRGQDLSVRRLSIRKRGSTLDWNGRVSEFKKKIRSILPGEDRNPLYDTSH
LPPERCDVVIVGGGVLGLSVAYWLKKLEKRQGAIRVLVVERDHTYSQASTGLSVGGIRQQ
FSLPENIQLSLFSASFLRNINEHLAVVDDPPLDLKFNPLGYLLLASEKGAATMENNVKVQ
RQEGAKVCLMSPEQLRNKFPWINTEGVALASYGMENEGWFDPWCLLQGLRRKVQSMGVFF
CQGEVTRFISSSSSMKNTSGEEVNLKRIYEVHVKMDHSLEYQPVECALVINAAGAWSGQI
AELAGIGKGPLGTLQGTKLPVEPRKRYVYLWHCPQGPGLEAPLVSDSSGAYFRREGLGNN
YIGGRSPTEEEEPDPKNLEVDHGFFQDKVWPPLAQRVPAFETLKVRSAWAGYYDYNTFDQ
NGVVGPHPLVMNMYFATGFSGHGLQQAPGVGRAVAEMVLEGHFQTIDLSSFFFSRFYLGE
KIQEHIII
Download sequence
Identical sequences H0WZI8
ENSOGAP00000008008 XP_003795974.1.62490 ENSOGAP00000008008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]