SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000008203 from Otolemur garnettii 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000008203
Domain Number 1 Region: 519-610
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 3.79e-40
Family Small-conductance potassium channel 0.0000026
Further Details:      
 
Domain Number 2 Region: 388-559
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.16e-26
Family Voltage-gated potassium channels 0.004
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000008203
Domain Number - Region: 21-136
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00445
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000008203   Gene: ENSOGAG00000009146   Transcript: ENSOGAT00000009151
Sequence length 703
Comment pep:novel scaffold:OtoGar3:GL873549.1:5841289:5979351:-1 gene:ENSOGAG00000009146 transcript:ENSOGAT00000009151 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PARGTREARAGSSRRQRGSPPPAPPPPSPTLPRQQPPPPPRSSHLHCQQQQQSQDKPCPP
FAPLPHPHHHPHLAHQQPGSGGSSPCLRCNSCASSGAPAAGAGAGDNLSLLLRTSSPGGA
FRTRTSSPLSGSSHHQHHQPQARRESNPFTEIAMSSCRYNGGVMRPLSNLSASRRNLHEM
DSEAQPLQPPASVGAPEIVVSKPEHNNSNNLALYGAAGGGGGGGGGSSSGTKTSKKKNQN
IGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSWGAYDKASLYSLALKCLISL
STIILLGLIIVYHAREIQLFMVDNGADDWRIAMTYERIFFICLEILVCAIHPIPGNYTFT
WTARLAFSYAPSTTTADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINF
NTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRACERYHDQQDVTSNFLGAMWLISITF
LSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLT
KRVKNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQA
NTLVDLAKTQNIMYDMISDLNERSEDFEKRIVTLETKLETLIGSIHALPGLISQTIRQQQ
RDFIEAQMDSYDKHVPYNAERSRSSSRRRRSSSTAPPTSSESS
Download sequence
Identical sequences H0WZZ6
ENSOGAP00000008203 ENSOGAP00000008203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]