SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000008311 from Otolemur garnettii 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000008311
Domain Number 1 Region: 28-123
Classification Level Classification E-value
Superfamily Snake toxin-like 3.68e-23
Family Extracellular domain of cell surface receptors 0.023
Further Details:      
 
Domain Number 2 Region: 136-224
Classification Level Classification E-value
Superfamily Snake toxin-like 0.0000000182
Family Extracellular domain of cell surface receptors 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000008311   Gene: ENSOGAG00000009282   Transcript: ENSOGAT00000009283
Sequence length 347
Comment pep:novel scaffold:OtoGar3:GL873671.1:935301:938585:-1 gene:ENSOGAG00000009282 transcript:ENSOGAT00000009283 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPVGKAGAQAVIWRTGWLLLPLLLNQGTQALECYSCVQRADDGCSPHKMKTVKCGPGVD
VCTEAVGAVETIHGQFSVAVRGCGSGLRGKNDRGLDLHGLLAFIQLQQCAQDRCNSKLNL
TSRTLNPAGNESAYRPNGMECYSCVGLSREACQGTAPPVVSCYNAGDQVYKGCFDGNVTL
TAANVTVSLPVRGCVQDEFCTRDGVTGPGFTLSGSCCQGSRCNFDLRNRTYFSPKFPPLV
LLPAPKATTVASTTSVATSTLASTTSTPTTKPTQAPTTQTPTQKVEHEASGGEETNLTGG
PIVHQDRSNMEQYPQKGGAQHLPNKGSAAPTAKLLAFLLAVAAGVLL
Download sequence
Identical sequences H0X086
ENSOGAP00000008311 XP_003799530.1.62490 ENSOGAP00000008311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]