SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000008501 from Otolemur garnettii 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000008501
Domain Number 1 Region: 20-252
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.55e-69
Family BAR domain 0.00042
Further Details:      
 
Domain Number 2 Region: 244-276,308-365
Classification Level Classification E-value
Superfamily SH3-domain 1.81e-17
Family SH3-domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000008501   Gene: ENSOGAG00000009494   Transcript: ENSOGAT00000009499
Sequence length 366
Comment pep:novel scaffold:OtoGar3:GL873529.1:21545430:21583450:-1 gene:ENSOGAG00000009494 transcript:ENSOGAT00000009499 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNIMDFNVKKLAADAGTFLSRAVQFTEEKLGQAEKTELDAHLENLLSKAECTKIWTEKIM
KQTEVLLQPNPNARIEEFVYEKLDRKAPTRVNNPELLGQHMIDAGTEFGPGTAYGNALIK
CGEAQKRIGSADRELIQTSALNFLTPLRNFIEGDYKTIAKERKLLQNKRLDLDAAKTRLK
KAKAAETRNSSEQELRISQSEFDRQAEITRLLLEGISSTHAHHLRCLHDFVEAQMTYYAQ
CYQYMLDLQKQLGSFPSNYLCNNNQNSVTPAPSVLPNVIGSSAMASTSGLVITSPPSNLS
DVKEYSGSRKARVLYDYDAANSTELSLLADEVITVFSVIGMDSDWLMGERGNQKGKVPIT
YLELLN
Download sequence
Identical sequences H0X0P7
XP_003784226.1.62490 ENSOGAP00000008501 ENSOGAP00000008501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]