SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000008657 from Otolemur garnettii 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000008657
Domain Number 1 Region: 86-148
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 4.84e-18
Family HLH, helix-loop-helix DNA-binding domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000008657   Gene: ENSOGAG00000009685   Transcript: ENSOGAT00000009684
Sequence length 331
Comment pep:novel scaffold:OtoGar3:GL873562.1:9050129:9051124:1 gene:ENSOGAG00000009685 transcript:ENSOGAT00000009684 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKAYVKSKEMVELVNTPSWMEKGLGSQNEMKEEERRPGAYGLLGSLTEEHDSIEEEEEE
EEDGEKPKRRGPKKKKMTKARLERFRARRVKANARERTRMHGLNDALDNLRRVMPCYSKT
QKLSKIETLRLARNYIWALSEVLETGQTPEGKGFVEMLCKGLSQPTSNLVAGCLQLGPQS
VLQEKHDEKSPICDSTISVHNFNYQSPGLPSPPYGHMETHLLHLKPQVFKSLGESSFGSH
PPDCGTPPYEGPLTPPLSISGNFSLKQDGSPDLEKSYTFMPHYPSASLNSGHVHSAPFQA
GTPRYDVPIDMSYDSYPHHGIGSQLNTIFTE
Download sequence
Identical sequences H0X121
ENSOGAP00000008657 ENSOGAP00000008657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]