SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000010586 from Otolemur garnettii 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000010586
Domain Number 1 Region: 864-1074
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.97e-55
Family DBL homology domain (DH-domain) 0.00027
Further Details:      
 
Domain Number 2 Region: 1237-1423
Classification Level Classification E-value
Superfamily PH domain-like 7.25e-26
Family Pleckstrin-homology domain (PH domain) 0.0000059
Further Details:      
 
Domain Number 3 Region: 1063-1183
Classification Level Classification E-value
Superfamily PH domain-like 4.28e-25
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000010586   Gene: ENSOGAG00000011825   Transcript: ENSOGAT00000011832
Sequence length 1427
Comment pep:novel scaffold:OtoGar3:GL873526.1:24762045:24880549:1 gene:ENSOGAG00000011825 transcript:ENSOGAT00000011832 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFAFLEIKKPPVAPKPKFIAANNKPAPPPVAPKPDIVISSVPQATKKAKPAIAPKPKVLK
SSVQDGGQSPSRKRTLNLEEHKQELAESTANFNGKNVGEQNNDYTLPMCSCSSECIHKLA
NRENVCVKQLVLEPLGMNENLQNCKPDESLTVKTMSKYDSPGEKAKNQTNVVFKANVLEE
KLKDVLTHRMSPFISSKKHRSADNPEMNGGYNSHRQFRIEFEDLLPSPPSFENAPDRHNC
HFKLPSDEFQNFEACQDGSEKSNSDFYSSKPEALENSKKGTLISSDEVSKKSEVKDLGPL
EIHLVSYSPKFPTPKPRKTRAARLLRQKYVDAPSESTEEPENSTSSSSCLSEDSLKNNEI
SVLHPSSQEQVDKMNPGNKKELKVDPNSDRQALVKSQKARCQETSSFEKTTPSLDADSDL
TSDSTAIDGSSTSLGVDKGTSFIRCSTLSMSLPKQLKLTCSEHLPAACNLGVSTPQMQKE
SIIKEEVSSRIVPKKPQRHSLPATGVLKKAASEELVEKSSYPSSEKHSEKGLERNHLQHL
CAQNHGVSSSDVPKQASEKPVWKLPHPILPFSGNPESLKSVTSNSEPSTALTKPRAKSLS
AVDMERCTKPCKDSTKKNSFKKLLNMKLSICFMKSDFQKFWSRSSQLGDTTAGSFCHRER
KRIEGDWHGLLGGEGRRSKPTKAYSADNNYSLESQKKGRKSRGQTSAPNGLRAESLDDQM
LSRESSPKTPCKSVTSLCAPEYENIRHYEEIPEYENLPFIMAVGKSPEQEWQNPSSMEDT
DANVYEVEEPYEAPDGQLPLGPRHQHSSSSGASQEGQNDLDLGLGDLPSDEEEVLNSSDE
DDVSSESSKGEADPLEDKQGEDNGMKSKVHHIAKEIMSSEKVFVDVLKLLHIDFRDAVAH
VSRQLGKPVIEDRILNQILYYLPQLYELNRDLLKELEERMLNWTEQQRIADIFVKKGPYL
KMYSTYIKEFDKNIALLDEQCKKNPGFAAIVREFEMSPRCANLALKHYLLKPVQRIPQYR
LLLTDYLKNLKEDARDYRDTQDALAVVIEVANHANDTMKQGDNFQKLMQIQYSLNGHHEI
VQPGRVFLKEGTLMKLSRKVMQPRMFFLFNDALLYTTPVQSGMYKLNNMLSLAGMKVRKP
TQEAYQNELKIESVERSFILSASSATERDEWLEAISRSIEDYARKRITFCPSRSLEEADS
ENKEEVSPLGSKAPIWIPDTRATMCMICTSEFTLTWRRHHCRACGKIVCQACSSNKYGLD
YLKNQPARVCEHCFEELQKLDHQHSPKIGSPGNHKSPSSALSSVLHSIPSGRKQKKIPAA
LKEVSANTEDSSMSGYLYRSKGNKKPWKHLWFVIKNKVLYTYAASEDVAALESQPLLGFT
VTQVRDENSESKVFQLLHKNMLFYVFKADDAHSAQKWIEAFQEGTIL
Download sequence
Identical sequences H0X5L7
ENSOGAP00000010586 ENSOGAP00000010586

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]