SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000011002 from Otolemur garnettii 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000011002
Domain Number 1 Region: 367-458
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 2.75e-39
Family Small-conductance potassium channel 0.00000488
Further Details:      
 
Domain Number 2 Region: 236-409
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.35e-26
Family Voltage-gated potassium channels 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000011002   Gene: ENSOGAG00000012295   Transcript: ENSOGAT00000012300
Sequence length 504
Comment pep:novel scaffold:OtoGar3:GL873624.1:3183837:3213631:1 gene:ENSOGAG00000012295 transcript:ENSOGAT00000012300 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSHSHNGSVGRPLVSGPGALSHDPPDPEAGCSPRPPHSPGLQVVVAKSEPARSSPGSPR
GQPQDQDDDEEDEEDEEGGQRGSGKPPNVGHRLGHRRALFEKRKRLSDYALIFGMFGIVV
MVTETELSWGVYTKESLYSFALKCLISLSTVILLGLVVLYHAREIQLFMVDNGADDWRIA
MTCERVFLISLELAVCAIHPVPGHYRFTWTARLAFTYAPSVAEADVDVLLSIPMFLRLYL
LGRVMLLHSKIFTDASSRSIGALNKITFNTRFVMKTLMTICPGTVLLVFSISSWIIAAWT
VRVCERYHDKQEVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTAL
VVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKHTRLVKKPDQARV
RKHQRKFLQAIHQLRSVKIEQGKLNDQANTITDLAKTQSIMYDLVSELHAQHEELEARLA
ALESRLDALGASLQALPGLIVQAI
Download sequence
Identical sequences H0X6L0
ENSOGAP00000011002 ENSOGAP00000011002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]