SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000011388 from Otolemur garnettii 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000011388
Domain Number 1 Region: 1243-1347,1401-1557
Classification Level Classification E-value
Superfamily Cullin homology domain 6.41e-40
Family Cullin homology domain 0.001
Further Details:      
 
Domain Number 2 Region: 806-998
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.65e-36
Family APC10-like 0.0044
Further Details:      
 
Domain Number 3 Region: 392-466
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 5.72e-32
Family CPH domain 0.00000694
Further Details:      
 
Domain Number 4 Region: 114-195,506-596,648-793,964-998,1070-1103
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000394
Family PBS lyase HEAT-like repeat 0.06
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000011388
Domain Number - Region: 1575-1674
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0132
Family Penicillinase repressor 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000011388   Gene: ENSOGAG00000012700   Transcript: ENSOGAT00000012711
Sequence length 1726
Comment pep:novel scaffold:OtoGar3:GL873550.1:13587090:13601822:-1 gene:ENSOGAG00000012700 transcript:ENSOGAT00000012711 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVGELRYREFRVPLGPGLHAYPDELIRQRVGHNGHPEYQIRWLILRRGDDGEGGSSQVDC
KAEHILLWMSNDEIYANCHKMLGEDGQVIGPSQESTGEAGALDKSVLGEMETDVKSLIQR
ALRQLEECVGSIPPAPLLHTVHVLSAYASIEPLTGVFKDPRVLDLLMHMLSSPDYQIRWS
AGRMIQALSSHDAGEGPCGEEGKAGEGLGQLRDSQNTVAEASDLIRTRTQILLSLSQQEA
IEKHLDFDSRCALLALFAQATLSEHPMSFEGIQLPQVPGRLLFSLVKHYLHVTSLLDQLN
DSAAKLGAQNNSAPEELSGERSRLELEFSMAMGTLISELVQTMRWDPASSRPGSSARPPC
SIFRPQLADVSSGLQPAQAQPSVRRSRRFRPRSEFASGNTYAMYVRDTLQPGMRVRMLDD
YEEISAGDEGEFRQSNSGVPPVQVLWESTGRTYWVHWHMLEILGFEEDIVEDMVAADEYQ
GAVGSRALGGVLPSWRWKPMTELYAVPYVPPEDEDTEESEHLTQAEWWELLYFIKKLDGP
DHQEVLQILQENLDGEHILDDEILAELAVPIEMAQDLLLTLPQRLDDSALRDLINCRVYR
KYGPEAHPTLLEAQQDVLLLEPQAQAQKSEDPARVEVKETPSQSPSTPLQRLVEDYGPAG
KILLDLEQALSSEGIQESKVRPFLLQLLRQPQPFLALMQSLDTSETNRALHLAVLRILMK
LVDFPEALLLPWHEAMDACMACLRSPNTDREVLQELIFFLHRLTSVSRDYAVVLNQLGAR
DAISKALEKHLGKLELAQELRDMVFKCEKHAHLYRKLTTNILGGCIQMVLGQIEDHRRTH
RPINIPFFDVFLRYLCQGSSVEVKEDKCWEKVEVSSNPHRASKLTDRNPKTYWESNGSTG
SHYITLHMRQGVLVRQLTLLVASEDASYMPARVVVYAGDSINSLNTEVNSVNVMPSASRV
ILLENLNHFWPIIQIRIKRCQQGGIDTRIRGLEILGPKPTFWPVFREQLCRHTRLFYMVR
AQAWSQDMAEDRRSLLHLSSRLNGALRQEQNFADCFLPDDEAARALGKTCWEALVSPLVQ
NITSPDEDGISPLGWLLDQYLECREAAHNPQSRAAAFSSRVRRLTHLLVHVEPCEVSPPV
VTTPRPKGRNRSHDWSSLATRGLPSSIMRNLTRCWRSVVEEQVNNFLTSSWRDDDFVPRY
CERFNSLQKSSSELFGPRAAFLLALQNGCAGALLKLPFLRAAHVSEQFARHIDQRIQGSR
IGGARGMEMLAQLQRCLEAVLIFCGLEIATTFEHYYQHYMADRLLGVGSSWLEGAVLEQI
GPCFPNRLPQQMLRSLSTSEELQRQFHVYQLQRLDQELLKLEDTEKKIQVGQETGGEEHE
SEKDEEAGAAAAMGLVEGEEEEEENEDLYYEGTMPEVSVLVLSPRCWPIASICHTLNPRT
CLPPYLRGTLNRYSNFYSKSQRHPTLEQGSQRRLQWTWLGRAELQFGDQTLHVSTVQMWL
LLYLNDLKVVSVESLLELSGLSPDMLNQAIAPLTSARGPLDLHEPKDVPGGVLKIRDGSE
EPRPRRGNVWLIPPQTYLKAEDEEGRNLEKRRNLLNCLIVRILKAHGDEGLHIDQLVCLV
LEAWQKGPCPSRGLVNSLGRGSACSSTDVFSCILHLLGKGTLRRRDDRPQMLSYAVPVTV
MEPHTESLNPGCSGPNPPLTFHTLQIRSRGVPYASCTGTQSFSTFR
Download sequence
Identical sequences H0X7K0
ENSOGAP00000011388 ENSOGAP00000011388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]