SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000011896 from Otolemur garnettii 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000011896
Domain Number 1 Region: 161-347
Classification Level Classification E-value
Superfamily PH domain-like 1.26e-56
Family Phosphotyrosine-binding domain (PTB) 0.00000036
Further Details:      
 
Domain Number 2 Region: 492-611
Classification Level Classification E-value
Superfamily SH2 domain 5.52e-26
Family SH2 domain 0.0000189
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000011896   Gene: ENSOGAG00000013273   Transcript: ENSOGAT00000013278
Sequence length 632
Comment pep:novel scaffold:OtoGar3:GL873530.1:1879954:2003000:-1 gene:ENSOGAG00000013273 transcript:ENSOGAT00000013278 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRERGQDSLAGLVLYVGLFGHPGMLHRAKYSRFRNESSTSLDEGSPGGSGGNKSSQQPPY
PTLAPHLPAEDATLASQESPTPLCTLIPRMASMKLANPATLLSLKNFCLGTKEVPRLKLQ
ESQDPAPSSPASPETSLNRVESAPSLQPDPVGHRANASSPDRCPLPRPGEPPPRSRPDRH
FLQHLLGIGMNYCVRYMGCIEVLQSMRSLDFGMRTQVTREAISRLCEAVPGANGAIKKRK
PPVKCLSTVLGKSNLQFSGMNIKLTISTCSLVLMNLDNQQIIANHHMQSISFASGGDPDT
TDYVAYVAKDPVNQRACHILECRNGMAQDVISTIGQAFELRFKQYLKNPSLNTSCEREEE
VHVDCPAEEREDHEYYNEIPGKQPPAGGVSDVRIKVQATEKMSYCPLRCEKLCYLPGNSK
HSSVYENCLEQNKATGNAHERGVQAQRDASSVKHTTCRADLFDDPCYINTQALQSILGST
RNQSSAQPLGSPWHYGKPPETVQPGATAQTASSHSLPHIEQQLRNEECYHGKLSRKAAES
LLVKDGDFLVRESTTSPGQFVLSGLQGGQAKHLLLVDPEGKVRTKDHVFDNVGHLIRYHM
DNSLPIISSGREVNLKQPVRKDHNLGLLRSNK
Download sequence
Identical sequences H0X8R2
ENSOGAP00000011896 ENSOGAP00000011896 XP_003784388.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]