SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000011904 from Otolemur garnettii 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000011904
Domain Number 1 Region: 929-1140
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.62e-41
Family DBL homology domain (DH-domain) 0.0017
Further Details:      
 
Domain Number 2 Region: 1303-1504
Classification Level Classification E-value
Superfamily PH domain-like 1.29e-32
Family Pleckstrin-homology domain (PH domain) 0.0001
Further Details:      
 
Domain Number 3 Region: 1130-1251
Classification Level Classification E-value
Superfamily PH domain-like 1.65e-19
Family Pleckstrin-homology domain (PH domain) 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000011904   Gene: ENSOGAG00000013279   Transcript: ENSOGAT00000013286
Sequence length 1506
Comment pep:novel scaffold:OtoGar3:GL873620.1:5171807:5308090:1 gene:ENSOGAG00000013279 transcript:ENSOGAT00000013286 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DSPKPPLAPKPKTTSPLTPRTAPKFPSSSRPNSLHSPNFMFRGPKPPIAPKPRLAAPSEW
RASVYMNNSVNKCSNGRLLCIDRGLEEGHRPNPECSESETDEDYIVAPGGPLSEDEPKDG
GDAENEGMAPPAASGEEEEEHEQRGEARGMEGAGAGENSAAPADGVPSREGEEDVDHTPE
NGQEGCDDDAGTEEQVSTSEEEEKLVKEHNAYNLESGDGEEDFPSNIILTFADVGDPATP
GEEPGPLKAPMEVEEDGEEGCVNTKPGGPPKDTEQNADEASEEPPENEELALGVQEAEMG
PGDPEISKEKCEDITGIGDQVDQDEPSDRDDETNHEEIAAASQEVLGDPHDGEDPVQAQP
AEDSCHIVPFESDCLDDLVTSLTGSPYEFFPTESTSFCSENYSPLSESAKGLESEQEPKS
GVCAGTSRGQQDSLQDGAEEGPFVPDVVVMPEEEDAADDSLTNPYVMGVGLMCQADPGEG
ECSEMQASSDVPSGYGTKEDMNSDAEGSLVPTDRKNIATRARPHSGKVAGYVPETVPEET
GPEAGSSAMGIRGAPEDARKTVLSLEGKPQEASRALPAKPRAFTLYPRSFSVEGREIPVS
VYREPEGSGLDDHRMKRKEDNLSLPCVIGSSGSFSQRNHLPSSGTSTPSSVVDIPPPFDL
ACITKKPITKSSPSLLVESDSPDKHTKKKKSSFKRFLALTFKKKTENKVHVDVNVSSSRS
SSESSYHGPSRILEIDRRSLSNSPQLKSRTGKLRASESPSSLIFYRDGKRKGVPFSRTVS
RVESFEDRSRPPFLPLPLTKPRSISFPNADTSDYENIPAMNSDYENIQIPPRRPARAGTF
TKLFEDQSRALSTANENDGYVDMSSFNTFESKQQSTDLEAESAYTEPYKVCPISVVAPKE
DLTSDEEQRSSEEEDSAPRDPSLTHKVEGQSRALVIAQELLSSEKAYVEMLQHLHLDFHG
AIMKALNDMDQEGRDTLAREELKQSLSELPAIHDLHQGILQELEERLSNWESQQKVADVF
LAREQEFDHHATHILQFDRSLALLGENCLHSPRLAAAVREFEQSLQGDGQTMKHHLLRVV
QRLFQYQVLLTDYLNNLCPDSAEYDNTQGVLTLISKVTDRANDSMEQGENLQKLVHIEHS
VQGQGDLLQPGREFLKEGTLMKVTGKNRRPRHLFLMSDMLLYTYPQKDGKYRLKSSLLVA
NMKVSRPVMEKVPYALKIETSESCLMLSASPCRSSCAERDEWYGCLSRALPEDYKAQALA
AFHHSVEIRERLGVSLGERPPTLVPVTHVMMCMNCGCDFSLTLRRHHCHACGKIVCRNCS
RNKYPLKYLKDRMAKVCDGCFGELRKRGGAVPGLMRERPVSMSFPLSAPRFSGSAFSSVF
HSINPSTFKKQKKVPSALSEVAASGEGSVISGYLSRCKKGRRYWKKLWFVIKGKVLYTYM
ASEDKVAMESMPLLGFTIAPEKEEGSSEVGPTFHLYHKKTLFYSFKAEDTNSAQRWIKAM
EDASVL
Download sequence
Identical sequences H0X8S0
ENSOGAP00000011904 ENSOGAP00000011904

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]