SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000012066 from Otolemur garnettii 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000012066
Domain Number 1 Region: 5370-5528
Classification Level Classification E-value
Superfamily SET domain 9.42e-49
Family Histone lysine methyltransferases 0.0065
Further Details:      
 
Domain Number 2 Region: 1417-1477
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000509
Family PHD domain 0.0039
Further Details:      
 
Domain Number 3 Region: 272-326
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000997
Family PHD domain 0.0022
Further Details:      
 
Domain Number 4 Region: 1492-1561
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000144
Family PHD domain 0.025
Further Details:      
 
Domain Number 5 Region: 1371-1425
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000117
Family PHD domain 0.017
Further Details:      
 
Domain Number 6 Region: 224-276
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000225
Family PHD domain 0.01
Further Details:      
 
Domain Number 7 Region: 2019-2069
Classification Level Classification E-value
Superfamily HMG-box 0.00000223
Family HMG-box 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000012066   Gene: ENSOGAG00000013443   Transcript: ENSOGAT00000013471
Sequence length 5528
Comment pep:novel scaffold:OtoGar3:GL873589.1:9259715:9295552:-1 gene:ENSOGAG00000013443 transcript:ENSOGAT00000013471 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSQKQPGEDKDSEPAADGPAASEDPGATEPDLPKTHVGEVSVPTSGSTRLQKASQDCSG
GPVRRCALCNCGEPSLHGQRELRRFQLPFDWPRCPVVSPGGNPGPNEVVLPSEDLSQIGF
PEGLTPAHLGEPGGSCWAHYWCAVWSAGVWGQEGPELCGVDKAIFSGISQRCSHCTRLGA
SIPCRSPGCPRLYHFPCATASGSFLSMKTLQLLCPEHSEGATHLEEARCTVCEGPGELCD
LFFCTSCGHHYHGACLDTALTARKRAGWQCPECKVCQACRKPGNDSKMLVCETCDKGYHT
FCLKPPMEELPAHSWKCKACRICRTCGASSAELNPNSEWFENFSLCHRCHKAQGGQPVSS
VAEQHPPVCSRFSPPEPGNNPTDEPDALYVACQGQPKGGHVTSMQPKEPGPLQCEAKPLG
EAGVQLEPQLEVPLNEEMPLLPPPEESPLSPPPEESPTSPPPEASRLSPPPEESPTSPPP
EALHLSAPSEESPLSPPPEESPLSPPPESSPFSPLEELPFSPPEESPPSPALETPLSPPP
EASPLSPPFEESPLSPPPEELPTSPPPEASRLSPPPEESPMSPPPEESPMSPPPEASRPF
PPFEESPLSPPPEESPLSPPPEASRLSPPPEDSPMSPPPEDSPMSPPPEVSHLSPLPEVS
RLSPPPEESPLSPPPEESPRSPPPEASRLSPPPEDSPTSPPPEDSPTSPPPEDSLMSLPL
EESPLPVPPEPHLSPRPEEPHLSPRPEEPHLSPWPEEPHLSPRPEEPHLSPQPEELHLSP
VPKEPCLSPKPEEPHLSPRPEELRLSPQPEEPHLSPQPEEPLLSPRSEEPHLSPQPEEPC
LSPQHEEPRLSPHPEEPFLSPRPEEPCEDPGQRLTLEELPLFPPHGEPPLSPLLGEPALS
EPGEPPLSPLPEELPLSPSGEPSLSPQLMPPDPLPPPLSPIITAVAPPALSPLGELEYPF
GAKGDSDPESPLAAPILETPISPPPEANCTDPEPVPPMILPPSPGSPMELASPIPIEPLP
AQCSPLLHSLPPQNSPPALPLSMPSPLSPIGKAMEVLDEAEPQEMETEKVPEPECPALEP
SATSPLLSPMGDLSCPAPSPAPSPAPALDDFTSLGEDITPLDGIDVPGSQPEAGQTPGSL
TSELKGSPVLLDPEELAPVTPMEVYGPECKQAAGQGSPCEEQEEPRAPVAPTPPTLIKSD
IVNEISNLSQGDASASFPGSEPLLGSPDPEGGGSLSMELGVSTDVSPARDEGSLRLCTDS
LPETDDSLLCDAGTAISGGKAEGEKGRRRSSPARSRIKQGRSSSFPGRRRPRGGAHGGRG
RGRARLKSTASSIETLVVADIDSSPSKEEEEEDDDTMQNTVVLFSNTDKFVLMQDMCVVC
GSFGRGAEGHLLACSQCSQCYHPYCVNSKITKVMLLKGWRCVECIVCEVCGQASDPSRLL
LCDDCDISYHTYCLDPPLLTVPKGGWKCKWCVSCMQCGAASPGFHCEWQNSYTHCGPCAS
LVTCPICHAPYVEEDLLIQCRHCERWMHAGCESLFTEDDVEQAADEGFDCVSCQPYIVKP
VVPIAPPELVPIKVKEPEPQYFRFEGVWLTETGMAVLRNLTMSPLHKRRQRRGRLGLPGE
AGMEGSEPTDALGPDDKKDVDLDTDELLKAEGGVEHMECEIKLEGPVSPDVEPGKEETEE
SKKRKRKPYRPGIGGFMVRQRKSHTRVKKGPAAQAEVLSGDGQPDEVMPADLPAEGSVEQ
SLADGDEKKKQQRRGRKKSKLEDMFPAYLQEAFFGKELLDLSRKALFAVGVGRPNFALGT
PKAKGDGGSERKELPTLQKGDDGPDVADEESRGPEGKADTPGPEDGGVKASPVPSDPEKP
GTPGEGMLSSDLDRIPTEELPKMESKDLQQLFKDVLGSEREQHLGCATPGLEGSRTPLQR
PFLQGGLPLGNLPSSSPMDSYPGLCQSPFLDSRERGGFFSPEPGEPDSPWTGSGGTTPST
PTTPTTEGEGDGLSYNQRSLQRWEKDEELGQLSTISPVLYANINFPNLKQDYPDWSSRCK
QIMKLWRKVPAADKAPYLQKAKDNRAAHRINKVQKQAESQINKQTKVGDIARKTDRPALH
LRIPPQPGALGSPPPAAAPTIFIGSPTTPAGLSTSADGFLKPPAGTVPGPDSPGELFLKL
PPQVPAQVPSQDPFGLAPTYALEPRFPTAPPSYAPYPSPTGAPSQPSMLGTSSRPGTGQP
GEFHTTPPGTPRHQPSTPDPFLKPRCPSLDNLAVPESPGVGGSKASEPLLSPPPLGESRK
ALEVKKEELGASSPSYGPPNLGFVDSPSSGPHLGGLELKAPDVFKAPLTPRASQVEPQSP
GMGLRPQEPSPAQALAPSPPSHPDIFRPGPYSDPYAQPPLTPRPQPPPPENCCALPPRSL
PSDPFSRVPASPQSQSSSQSPLTPRPLSAEAFCPSPVTPRFQSPDPYSRPPSRPQSRDPF
APLHKPPRPQPPEVAFKAGPLAHTPLGAGGFPAALPSGPAGELHAKVPSGQAPNFSRSPG
TGAFVGTSSPMRFTFPQAVGEPSLKPPVPQPGLPPPHGINSHFGPGPTLGKPQSTNYAVA
TGNFHPSGSPLGPSSGSTGESYGLSPLRPPSVLPPPAPDGSLSYLSHGASQRSGITSPVE
KREDPGTGTGSSSMATPEIPGTQDPGMSNLSQTELEKQRQRQRLRELLIRQQIQRNTLRQ
EKETAAAAAGAVGPSANWGAEPSSPAFEQLSRAQTPFVGTQDKSNLVGLPPSKLSGPILG
PGAFSSDDRLSRPPPPATPSSVDVNSRQLVGGSQAFYQRAPYPGSLPLQQQQQQLWQQQQ
ATAATSMRLAMSTRFPSTPGPELGRQALGSPLAGISTRLPGPGEPVPGPAGPAQFIELRH
NVQKGLGPGVAPFPGQGPPQRPRFYPVSEDPHRLAPEGLRGLAISGLPPQKPSAPSAPEL
NNSLHPTPHTKGPTLPTGLELVSRPPSSTELGRPTPLALEAGKLPCEDSELDDDFDAHKA
LEDDEELAHLGLGVDVAKGDDELGTLENLETNDPHLDDLLNGDEFDLLAYTDPELDTGDK
KDIFNEHLRLVESANEKAEREALLRGVEPGPLGPEERPSPATDASEPRLASVLPEVKPKV
EEGGRHPSPCQFTITTPKVEPAPATTSLGLGLKPGQSMLGSRDTRMSTGPFSSSGHTAEK
GPYGATGPPAHLLTPSPLSGPGGSSLLEKFELESGTLTLPGGHTASGDELDKMESSLVAS
ELPLLIEDLLEHEKKELQKKQQLSAQLQPAQQQHSLLSTPGAPQAMSLPHEGSSPSLAGP
QQQLALSLGGARQPGLAQPLMPTQPPAHALQQRLAPSMAMVSNQGHMLSGQHGQAGLVHQ
QSPQPVLSQKPMGTMPPSMCMKPQQLAMQQQLANSFFPDTDLDKFAAEDIIDPIAKAKMV
ALKGIKKVMAQGSIGVAPINRQQVSLLAQRLSGGAGSDLQNHVAAGSGQERSASDPSQSR
PNPPTFAQGVINEADQRQYEEWLFHTQQLLQMQLKVLEEQIGVHRKSRKALCAKQRTAKK
AGREFPEADAEKLKLVTEQQSKIQKQLDQVRKQQKEHTNLMAEYRNKQQQQQQQQQQQQQ
QQQQQQQQQQQHSAVLALSPSQSPRLLTKLPSQLLPGHGLQPPQGPPGGQTGGLRLPPGG
MALPGQPGGPFLNTALAQQQQQHSGGAGSLAGPSGGFFPGNLALRGLGPDSRLLQERQLQ
LQQQQQRMQLAQKLQQQQQHLLGQVAIQQQQQQGPGVQTNQAVGPKPQGLLPPSTHQGLL
VQQLSPQPPQGPQGMLGPAQVAVLQQQHPGALGPQGPHRQVLMTQSRVLSSPQLAQPGQG
LMAHRLVTAQQQQQQQQHQQQGSMAGLSHLQQGLMSHSTQPKLSAQPMGSLQQQQIQQQQ
QQQLQQQQQQQLQQQQQQQLQQQQLQQQQLQXXXXXXXXXXXXXXXXXXXXXXXQQQQQQ
QQQQQQMGLLNQSRTTLLQQQQQQQVALGPGVPAKPLQHFSSPGALGPTLLLTGKEQNVE
TALPSEVTEGPSTHQGGPLAVGTTPESMGTEPGEVKPSLSGDSQLLLPQPQPQPQPSSLQ
LQPPLRLPGQQQQQVNLLHTAGGGSHGQLSSGSSSEVSSIPHLLAQPSVSLGEQPGPMTQ
NLLGSQQPTGLERPMQNNTGPQPPKQGPVAQSGQGLPGVGVMPTVGQLRAQLQGVLAKNP
QLRHLSPQQQQQLQALLMQRQLQQSQAVRQTPPYQEPGTQPSPLQGLLGCQPQLGGFPGS
QTGPLQELGAGPRPQGPPRLPAPQGALSTGPVVGPVHPTPPPSSPQEPKRPSQLPSPSSQ
LPPETQLTPTQPGTPKPQGPPLELPPGRVSPAAAQLADTLFGKGLGPWDPPDNIAEAQKS
EQSSLVAGHLEQVNGQVVSEPPQLSIKQEPREEPCALGAQAVKREANGEPIGAPGTSNHL
LLAGPRSEAGHLLLQKLLRAKNVQLNSGRGSEGLRTEINGHIDSKLAGLEQKLQGTPSNK
EDVAARKPLTPKPKRVQKASDRLVSSRKKLRKEDGVRASEALLKQLKQELSLLPLTEPAI
TANFSLFAPFGSGCPVNGQSQLRGAFGSGVLSTGPDYYSQLLTKNNLSNPPTPPSSLPPT
PPPSVQQKMVNGVTPSEELGEHPKDAASARDTDGALRDASEVKSLDLLAALPTPPHNQTE
DVRMESDEDSDSPDSIVPASSPESILGEEAPRFPYLGSGRWEQDDRALSPVIPIIPRASI
PVFPDTKPYGALDLEVPAKLPTTSWEKGKGSEVSVMLTVSAAAAKNLNGVMVAVAELLSM
KIPNSYEVLFPESPARADIEPKKGEAEGPDGKEKGLGGKSPDAGPDWLKQFDAVLPGYTL
KSQLDILSLLKQESPAPEPPTQHSYTYNVSNLDVRQLSAPPPEEPSPPPSPLAPSPASPP
VEPLVELPAEPLAELPVPSPLPLASSPESSRPKARARPPEEGEDSHPPRLKKWKGVRWKR
LRLLLTIQKGSGRQEDEREVAEFMEQLGTALRPDKVPRDMRRCCFCHEEGDGATDGPARL
LNLDLDLWVHLNCALWSTEVYETQGGALMNVEVALHRGLLTKCSLCQRTGATSSCNRMRC
PNVYHFACAIRAKCMFFKDKTMLCPMHKIKGPCEQELSSFAVFRRVYIERDEVKQIASII
QRGERLHMFRVGGLVFHAIGQLLPHQMADFHSATALYPVGYEATRIYWSLRTNNRRCCYR
CSISENNGRPEFVIKVIEQGLEDLVFTDASPQAVWNRIIEPVAAMRKEADMLRLFPEYLK
GEELFGLTVHAVLRIAESLPGVESCQNYLFRYGRHPLMELPLMINPTGCARSEPKILTHY
KRPHTLNSTSMSKAYQSTFTGETNTPYSKQFVHSKSSQYRRLRTEWKNNVYLARSRIQGL
GLYAAKDLEKHTMVIEYIGTIIRNEVANRREKIYEEQNRGIYMFRINNEHVIDATLTGGP
ARYINHSCAPNCVAEVVTFDKEDKIIIISSRRIPKGEELTYDYQFDFEDDQHKIPCHCGA
WNCRKWMN
Download sequence
Identical sequences H0X956
ENSOGAP00000012066 ENSOGAP00000012066

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]