SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000012130 from Otolemur garnettii 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000012130
Domain Number 1 Region: 427-536
Classification Level Classification E-value
Superfamily SH2 domain 3.37e-32
Family SH2 domain 0.00000511
Further Details:      
 
Domain Number 2 Region: 102-198
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.99e-31
Family Ras-binding domain, RBD 0.00035
Further Details:      
 
Domain Number 3 Region: 229-341
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000466
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000012130   Gene: ENSOGAG00000013536   Transcript: ENSOGAT00000013540
Sequence length 539
Comment pep:novel scaffold:OtoGar3:GL873609.1:3590723:3700879:-1 gene:ENSOGAG00000013536 transcript:ENSOGAT00000013540 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTSLQDGQSAAGKAAARGSPLAAQVCGAAQGRGDARDLTPSHWPHARALLPPPDGTRGS
AADRRKKKDLDVLEMPSIPNPFPELCCSPFTSVLSAGLFPKANSRKKQVIKVYSEDETSR
ALDVPSDITARDVCQLLILKNHYIDDHSWTLFEHLPHIGVERTIEDHELVIEVLSNWGME
EENKLYFRKNYAKYEFFKNPMYFFPEHMVSFATETNGEISPTQILQMFLSSSTYPEIHGF
LHAKEQGKKSWKKIYFLLRRSGLYFSTKGTSKEPRHLQFFSEFGNSDIYVSLAGKKKHGA
PTNYGFCFKPNRAGRSRDLKVLCAEEEQSRTCWVTAIRLLKKERYAIKNHRTPFSGLPCS
SLKNSPKRSISENSLVAMDFSGQKSRVIENPTEALSVAVEEGLAWRKKGCLRLGTHSSAT
APSQSASTNLAIHQSQPWFHHRISREEAQRLISQQGPVDGVFLVRDSQSNPKTFVLSMSH
GQKIKHFQIIPVEDDGEMFHTLDDGHTRFTDLIQLVEFYQLNKGVLPCKLKHYCARIVL
Download sequence
Identical sequences H0X9A7
ENSOGAP00000012130 ENSOGAP00000012130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]