SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000013372 from Otolemur garnettii 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000013372
Domain Number 1 Region: 398-568
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.54e-56
Family SPRY domain 0.0000597
Further Details:      
 
Domain Number 2 Region: 194-253
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 2.75e-16
Family B-box zinc-binding domain 0.00085
Further Details:      
 
Domain Number 3 Region: 2-41,156-184
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000048
Family RING finger domain, C3HC4 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000013372   Gene: ENSOGAG00000014932   Transcript: ENSOGAT00000014936
Sequence length 571
Comment pep:novel scaffold:OtoGar3:GL873690.1:558831:619581:-1 gene:ENSOGAG00000014932 transcript:ENSOGAT00000014936 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQTLQEEAVCTIYLDYFKDPVSIACRHNFCHGCVTQLWGKENEEDREEDDEWKEDEEAVG
ATGGWDNSILEGNANEELFQDPEDDELWVGDSGVSNWNNVDYVWDGEEVDKEDRDYYPGG
LRLDLRTDVYPEDEEELEAYNEKEDEEVYPPPTPGQFICPQCQKSFRSNMQLANMIQIIR
QMCPTPYGGGGRTGQGICPKHQEALKLFCEDDGRAICVVCDRAREHRAHAVLPLDEAVQE
AKELLESRLRILRKELEDYEVFRSTEEKESKELLKQMATEQEKVGAEFQALRAFLVEQEG
RLLGRLEELSREVTQKQNENLAQLGGEITQLSKLCSQIQETAQKPDLDFLQIISYSRYEC
SVLSCRCSNVPGPKPTTVSSETFVLKGLLKKFKAQKCNHKAVELTLDPDTANPRLILSLD
LKSVRLGLRAQDLSSHPHRFDTNTRVLASCGFSSGRHHWEVEVGSKDGWAFGVARESVRR
KGLTPFTPEEGVWALQLNGGQYWAVTSPERTPLSCGHLSRVRVALDLEVGAVSFYAVEDM
RHLYTFRVNFQERVFPLFSVCSTGTYLRIWP
Download sequence
Identical sequences H0XC82
ENSOGAP00000013372 ENSOGAP00000013372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]