SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000014374 from Otolemur garnettii 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000014374
Domain Number 1 Region: 16-146
Classification Level Classification E-value
Superfamily PH domain-like 5.06e-27
Family Phosphotyrosine-binding domain (PTB) 0.0092
Further Details:      
 
Domain Number 2 Region: 272-392
Classification Level Classification E-value
Superfamily SH2 domain 0.0000000000000982
Family SH2 domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000014374   Gene: ENSOGAG00000016056   Transcript: ENSOGAT00000016060
Sequence length 427
Comment pep:novel scaffold:OtoGar3:GL873528.1:4492422:4498849:1 gene:ENSOGAG00000016056 transcript:ENSOGAT00000016060 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKAGAGGRRASDCGPTPLRPRCITKFAQYVGSFPVDDLDTQESVWLVQQQLWALKDCPR
RRAVILKFSLQGIKIYSGEGEVLLMAHALRRMLYSTWCPADCQFAFIARNPRSPPSKLFC
HLFVSSQPGEVHILHLLLCRSFQLAYLLQHPEERAQPEACPGPSGDMPQKPLSSPGGPCG
LVREPFSRDQLSQNVHALVSLRRLPAEGPVGSGKELLESEGRGGARLARLGNPYCSPTLV
RKKAIRSKVIRSGAYRGCTYETQLQLSAREAFPASWEAWPRGPGGPSCLVESDGSLTENV
WAFAGISRPCALTLLRRDALGAFLLWPEGTSGQWCLSVRTQCGVVPHQVFRNHLGRYCME
HLPAEFPSLEALVENHAVTERSLFCPLDMGRLNPTYEEQDCGPEGRPPRTLRPLGHAKSE
AELQGLG
Download sequence
Identical sequences H0XEJ6
XP_012657010.1.62490 ENSOGAP00000014374 ENSOGAP00000014374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]