SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000014799 from Otolemur garnettii 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000014799
Domain Number 1 Region: 441-671
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.51e-32
Family Voltage-gated potassium channels 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000014799   Gene: ENSOGAG00000016536   Transcript: ENSOGAT00000016539
Sequence length 776
Comment pep:novel scaffold:OtoGar3:GL873659.1:2868330:2877272:-1 gene:ENSOGAG00000016536 transcript:ENSOGAT00000016539 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQNLMSENTQNKADTDNLDMFSQHPSSSPRHSPGHRVAQHDGESRHHGTPHHHSGSHHS
PEFQDNTSSYYSYPSHHYSEVHHHGRTNSPTSSGPATSHGLVQSHDSYQKDSFNDEHYHD
SRMHHSGSHHQDGSYHHHSESPHHVGSHHGGSSHHIGSHHGGSPHHGGSSHHIGSHHSGS
PHHVGSHHSGSSHHIGSHHSGSPHHAGSHHGGSSHHIDFHHGRSHHHEAHHHRRPQHHGE
TASHISSEELYHHGHNEHHHGDYHPNEQHYGEHPHQRDHHHSEHAHQRIHQHHRDYSHYG
EHSSSLHPPDDLHGDHRYKEYHQSTSQLFVPHSLGKAPLSSTISSKPSHLSKGSTSTISQ
THSRVLSIGSQISNKVHPQDTASKDSESWDEEDEQFEKHKTGRSQRTHKKPRPPSFFTML
SEKLSYLIQGFRRMIWNLTHSWAFEIFIFFIICLNTVMLVAQTFAEVEIRGEWHFLALDC
IFFCIYVVEALLKIIALGLSYFRDYWNDLDFLIMIMAMLDFLLMQFNSSSSIYNQSLFRV
LKVCKSLRALRAIRVLRKFSILTSLQEVTGTLARSLPSITAILILMFTCLFLFSVVLRAL
FRKSDPKRFRSILTTIFTLFTMLTLDDWSLIYIDSRAQGAWYIIPILMIYIIIQYFIFLN
LVIAVLVDNFQMALLKGLEKVKQERAARIHEKILEDSITDLRKPEPEMVMSEGTMRKQFI
EKNFGPMTDKQQELLFHYLQLVAAVENQQQKFRSQASVANEIVDATFEVGEEDFKR
Download sequence
Identical sequences H0XFK4
ENSOGAP00000014799 ENSOGAP00000014799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]