SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000014823 from Otolemur garnettii 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000014823
Domain Number 1 Region: 75-113
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000262
Family LDL receptor-like module 0.0032
Further Details:      
 
Domain Number 2 Region: 169-210
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000262
Family LDL receptor-like module 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000014823   Gene: ENSOGAG00000016562   Transcript: ENSOGAT00000016566
Sequence length 212
Comment pep:novel scaffold:OtoGar3:GL873585.1:1147858:1157664:-1 gene:ENSOGAG00000016562 transcript:ENSOGAT00000016566 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKVFPQGDNGNGAAGTKALSGGAEGCSPFSCSRHRACLLASVLLLLATLAAFIALIIII
RLPLRMPGRQVCITLTNRTGFLCHDQRHCIPASRVCDGIRTCAHGEDEDEGLCQTPVRST
RPCPYQWYCLGDLASWTLEARECPGARPFQDTPAALLLVLISPVTECPPCGPGWWRCPST
VFKYCDCIPRSLCRDRVQHCSDWSDEYSCPGP
Download sequence
Identical sequences H0XFM6
ENSOGAP00000014823 ENSOGAP00000014823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]