SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000015157 from Otolemur garnettii 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000015157
Domain Number 1 Region: 826-1089
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.71e-32
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Domain Number 2 Region: 144-377
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.24e-32
Family Voltage-gated potassium channels 0.016
Further Details:      
 
Domain Number 3 Region: 505-660,700-778
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.62e-30
Family Voltage-gated potassium channels 0.022
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000015157
Domain Number - Region: 1094-1241
Classification Level Classification E-value
Superfamily EF-hand 0.00789
Family Calmodulin-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000015157   Gene: ENSOGAG00000016920   Transcript: ENSOGAT00000016932
Sequence length 1783
Comment pep:novel scaffold:OtoGar3:GL873551.1:2904291:3011490:1 gene:ENSOGAG00000016920 transcript:ENSOGAT00000016932 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVLFASPREFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENEEEGGEE
SKRNTSMPTSETESVNTENVSGEGETQGCCASLWCWWRRRDAAKTGPSGCRRWGQAISKS
KLSRRWRRWNRFNRRRCRAAVKSVTFYWLVIVLVFLNTLTISSEHYNQPDWLTQIQDIAN
KVLLALFTCEMLVKMYSLGLQAYFVSLFNRFDCFVVCGGITETILVELEIMSPLGISVFR
CVRLLRIFKVTRHWTSLSNLVASLLNSMKSIASLLLLLFLFIIIFSLLGMQLFGGKFNFD
ETQTKRSTFDNFPQALLTVFQILTGEDWNAVMYDGIMAYGGPSSSGMIVCIYFIILFICG
NYILLNVFLAIAVDNLADAESLNTAQKEEAEEKERKKIARKESLENKKNKPEVNQIANSD
NKVTIDDYQEEEEDKDPYPPCDVPVGEEEEEEEEDEPEVPAGPRPRRISELNMKEKITPI
PEGSAFFILSKTNPIRVGCHKLINHHIFTNLILVFIMLSSAALAAEDPIRSHSFRNTILG
YFDYAFTAIFTVEILLKMTTFGAFLHKGAFCRNYFNLLDMLVVGVSLVSFGIQSSAISVV
KILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMIVTTLLQFMFACIGVQLFKGK
FYRCTDEAKSNPEDCKGLFILYKDGDVDSPVVRERIWQNSDFNFDNVLSAMMALFTVSTF
EGWPALLYKAIDSNGENVGPVYNYRVEISIFFIIYIIIVAFFMMNIFVGFVIVTFQEQGE
KEYKNCELDKNQRQCVEYALKARPLRRYIPKNPYQYKFWYVVNSSPFEYMMFVLIMLNTL
CLAMQHYEQSKMFNDAMDILNMVFTGVFTVEMVLKVIAFKPKHYFTDAWNTFDALIVVGS
VVDIAITEVNPTESENVPVPTTTPGNSEESNRISITFFRLFRVMRLVKLLSRGEGIRTLL
WTFIKSFQALPYVALLIAMLFFIYAVIGMQMFGKVAMRDNNQINRNNNFQTFPQAVLLLF
RKRCATGEAWQEIMLACLPGKLCDPESDYNPGEEYTCGSNFAIVYFISFYMLCAFLIINL
FVAVIMDNFDYLTRDWSILGPHHLDEFKRIWSEYDPEAKGRIKHLDVVTLLRRIQPPLGF
GKLCPHRVACKRLVAMNMPLNSDGTVMFNATLFALVRTALKIKTEGNLEQANEELRAVIK
KIWKKTSMKLLDQVVPPAGDDEVTVGKFYATFLIQDYFRKFKKRKEQGLVGKYPAKNTTI
ALQAGLRTLHDIGPEIRRAISCDLQDDEPEETKREEEEDVFKRNGALLGNHVNHVNSDRR
DSLQQTNTTHRPLHVQRPSIPPASDTEKPLFPPAGNSVCHNHHNHNSIGKHVPTSTNANL
NNANMSKAAHGKRPSTGNLEHVSENGHHSSHKHDREPQRRSSIKRTRYYETYIRSDSGDE
QLPTICREDPEIHGYFRDPRCLGEQEYFSSEECYEDDSSPPASRQTYGYYSRYLGSNSDF
ERPRGYHHPQGFLEDDDSPVCYDSRRSPRRRLLPPTPTSHRRSSFNFECLRRQSSQEEVP
PSPIFPHRTALPLHLMQQQIMAVAGLDSSKAQKYSPSHSTRSWATPPATPPYQDWAPCYT
PLIQVERSESLDQVNGSLPSLHRSSWYTDEPDISYRTFTPASLTVPSSFRNKNSDKQRSA
DSLVEAVLISEGLGRYARDPKFVSATKHEIADACDLTIDEMESAASTLLNGNVHPRANGD
VGPTSHRQDYELQDFGPGYSDDEPDPGRDEEDLADEMICITTL
Download sequence
Identical sequences H0XGF3
ENSOGAP00000015157 ENSOGAP00000015157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]