SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000015330 from Otolemur garnettii 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000015330
Domain Number 1 Region: 370-633
Classification Level Classification E-value
Superfamily L domain-like 1.91e-42
Family Ngr ectodomain-like 0.0034
Further Details:      
 
Domain Number 2 Region: 667-815
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.06e-37
Family Toll/Interleukin receptor TIR domain 0.0000532
Further Details:      
 
Domain Number 3 Region: 26-325
Classification Level Classification E-value
Superfamily L domain-like 5.67e-33
Family Ngr ectodomain-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000015330   Gene: ENSOGAG00000017116   Transcript: ENSOGAT00000017120
Sequence length 843
Comment pep:novel scaffold:OtoGar3:GL873533.1:20783236:20800731:1 gene:ENSOGAG00000017116 transcript:ENSOGAT00000017120 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMFFSRLAGALIPAMAFLSCLRPESWEPCVEVVPNITYQCMELNLYKIPDNIPSSTKNLD
LSFNPLGHLGSHSFYSFSELQVLDLSRCEIQAIEENAFQNLNHLSTLILTGNPLRSLALG
AFSGLPSLQKLVAVETNLASLEDLPIGHLESLKELNVAHNLIHSFKLPEYFSNLLNLERL
DLSNNHIQNISHKDLQVLHRVPSRNLSLDLSLNPIDFIQPGSFKGIRLRELTLRSNFDSL
SVMKTCIQNLAGLEVHRLVLGEFKNERYIKDIDQSALEGLCNLTIEEFRLAYLDDSLQGA
ELLHCLENVSAISLVSLDLSHLKSLCNNFKWKSLELIDCKFEQFPILELFSLKRFIFTAN
RGGNTFIKVKLPDLEYLDLSKNGLSYTGCCSHTDLGTTRLTHLDMSFNGIITMTSNFLGL
EQLKHLDFQHSSLKQMSDFSVFLPLRNLLYLDLSYTHTQVAFHGIFDGLVSLQVLKMAGN
SFQDNILPDVFKEMTNLTFLDLSDCQLEQVSQKAFNTLSRLQLLNMSHNNLVSLDVLPYK
PLQSLQVLDFSFNRIVALRKQELQDFPRSLAFLNLTQNEFVCVCEHQSFLQWVKDQRQLL
VKAENMVCAMPLDMKGMSVLSFRNTTCQMNKTVISVSVVIVLMVSVVVVLVYKFYFHLML
LAGCKKYGTGESTYDAFVIYSSQDEDWVRNELVKNLEEGVPHFQLCLHYRDFIPGVAIAA
NIIQEGFHKSRKVIVVVSKHFIQSRWCIFEYEIAQTWQFLSSRAGIIFIVLQKVEKSLLR
QQVDLYCLLNRNTYLEWEDNALGRHIFWRRLRKALLDGKPWSPEAAAEPQAPSRKQQLLP
EKK
Download sequence
Identical sequences H0XGV9
ENSOGAP00000015330 ENSOGAP00000015330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]