SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000015481 from Otolemur garnettii 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000015481
Domain Number 1 Region: 268-380
Classification Level Classification E-value
Superfamily PH domain-like 2.18e-32
Family Pleckstrin-homology domain (PH domain) 0.0000786
Further Details:      
 
Domain Number 2 Region: 523-626
Classification Level Classification E-value
Superfamily SH2 domain 5.12e-25
Family SH2 domain 0.0000127
Further Details:      
 
Domain Number 3 Region: 24-83
Classification Level Classification E-value
Superfamily Phenylalanine zipper 1.83e-21
Family Adapter protein APS, dimerisation domain 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000015481   Gene: ENSOGAG00000028653   Transcript: ENSOGAT00000031180
Sequence length 756
Comment pep:novel scaffold:OtoGar3:GL873615.1:6365313:6373410:-1 gene:ENSOGAG00000028653 transcript:ENSOGAT00000031180 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGAPSPEDGASLSPPPLPPPPPPSWREFCESHARAAALDFAHRFRLYLASHPQYAGPGA
EAAFSRRFAELFLQHFEAEVARASGSLSPPILAPLSPGAEISHDLSLESCRVGGPLAVLG
PSRSSEDLAGPLPSSVSSSSTTSSKPKLKKRFSLRSVGRSVRGSVRGILQWRGTVDPSSP
AGPLETSSGLPVLGGNSNSNSSGGAGTVVRGLASDGMSPGERWTHRFEKLRLSRGGGTLK
DGAGMVQREELLSFMGAEEAAPDPTGVGRGGGAAGPTSGGGGQPQWQKCRLLLRSEGEGG
GGSRLEFFVPPKASRPRLSIPCSTITDVRTTTALEMPDRENTFVVKVEGPSEYILETADA
QHVKAWVSDIQDCLSPGPCPATSPRPMTLPLAPGTSFLSKENTDSLELSCLNHSESLPSQ
DVLLGPSESNDRLSQGAYGGLSDRPSASISPSSASIAASHFDSMELLPPELPPRIPIEEG
PPAGTVHPLSAPYPPLDTPETATGSFLFQGESEGGDGDQPLSGYPWFHGMLSRLKAAQLV
LTGGTGSHGVFLVRQSETRRGEYVLTFNFQGKAKHLRLSLNEEGQCRVQHLWFQSIFDML
EHFRVHPIPLESGGSSDVVLVSYVPSSQRQQESNTSHDPPQPPEPPSWTDLPHPGAEEAS
GAPEVAAATATAAKERQEKEKAGGGGLQEELVPVAELVPVVELEEAIVPGTEAQGGIGSG
GDSGVTPMVHLQQLPRGGDEEEGAHPRAINNQYSFV
Download sequence
Identical sequences H0XH91
ENSOGAP00000015481 ENSOGAP00000015481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]