SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000015889 from Otolemur garnettii 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000015889
Domain Number 1 Region: 31-121
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000179
Family V set domains (antibody variable domain-like) 0.011
Further Details:      
 
Domain Number 2 Region: 241-298
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000174
Family I set domains 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000015889   Gene: ENSOGAG00000027646   Transcript: ENSOGAT00000031171
Sequence length 306
Comment pep:novel scaffold:OtoGar3:GL873671.1:1883762:1890786:1 gene:ENSOGAG00000027646 transcript:ENSOGAT00000031171 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LALLSPSRILLTSCTCSASSELPFSVQLDSLTEGARVHLPVPGSLDGILSTSWFRGHKAQ
PAAMIFSAEGLPGPAYTGREMLGTHGSLVIRNVTAQDSGSYTVVLETSSGRRSATEQIHV
KRLQPSLLFGRSGLGIRTRHLRYACSCSSLLGKGTVIWARRAGALEEVLRWSGTLCPAPY
VIFKMGYFREVAGAFQTRNAQPLCVASAHLASLSVIADSFKTVPLLTFPETIQGIIQSDL
NYSVILEWVTTMNPEPVQTWTLNGKICGTGEKLFIRRLSWEQLGTYVCTATNSKEQLSSQ
PVTVSL
Download sequence
Identical sequences H0XIE9
ENSOGAP00000015889 ENSOGAP00000015889

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]