SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000016463 from Otolemur garnettii 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000016463
Domain Number 1 Region: 97-215
Classification Level Classification E-value
Superfamily PX domain 0.00000000000000327
Family PX domain 0.0034
Further Details:      
 
Domain Number 2 Region: 298-352
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000216
Family SAM (sterile alpha motif) domain 0.0052
Further Details:      
 
Domain Number 3 Region: 895-925
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000384
Family Retrovirus zinc finger-like domains 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000016463   Gene: ENSOGAG00000029811   Transcript: ENSOGAT00000025979
Sequence length 949
Comment pep:novel scaffold:OtoGar3:GL873704.1:1199348:1267211:-1 gene:ENSOGAG00000029811 transcript:ENSOGAT00000025979 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASNHPAFSFHQKQVLRQELTQIQSSLSGGGGHGGKSAPGSGGALPTCPACHKITPRTET
PVGSVSNSLENALQTSAHSTEELLPKRPLGKHSKVSVEKIDLKGLSHTKNDRNVECSFEV
LWSDSSVTSITKSSSEVTEFISKLSQLHPEENLEKLIPCLAGPDSFYVERNHMGLESGLR
YLASLPSHVLKNDHVKKFFSTSSPTQQLQSPSPGNPSLSKVGAVMGVPSRPVCGVAGIPS
SQSGAQHHVQHPAGSAPTLPHCSHTGGTGSALAYRTQMDASPAILMPSSLQAPQTQEQNG
ILDWLRKLRLHKYYPVFKQLTMEKFLSLTEEDLNKFESLTMGAKKKLKTQLELEKEKSER
RCLNPSGPSLVSSSGVARVPPTSHVGPVQAGRASHAAELRVEVEPAAHQLPREGSSSEYS
SSSSSPMGVQAREESSDSAEESDRRVEIHLEGPDKEKPVMLLSHFTSSSARPTAQVLPVQ
NEAGSTPSGHHPVPPQMMGAAPHVAPMRMLSSVHKSERGSSDMKLLPSSMHSLLSLEERS
KGSGPRSSVKVDKSFGGAMVDALPPPTPHQPVQVLSGLSESSSMSPTVSFGPRAKVVHAS
TLDRVLKTSQQPALVVETSTAAPGTPSSVLHAARPPIKLLLSPSVPADSAISGQTSCPNN
VQISVPPAIINPRTALYTANTKVAFSAVSSMPVGPLQGGFCASSSTASPSSLPATSFANM
ATLPSCPAPSSSPALSSVPESSFYSSSGSGASTGNIPASNPNHHHHHHHQQPAPPPQPAP
PPPGCVVCTSCGCSGSCGSSGLTVSYASYFQHPFSGPSVFPFPFLPFSPVCGSGYVGAQQ
YGGGSTFPVVHAPYSGSGTPEPVLGGQSTFPVPPMQNFMAGTAGVYQAQGLVGSSNGSSH
KKSGNLSCYNCGATGHRAQDCKQPSMDFNRQGTFRLKYAPPAESLDSTD
Download sequence
Identical sequences H0XK23
ENSOGAP00000016463 ENSOGAP00000016463

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]