SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000016707 from Otolemur garnettii 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000016707
Domain Number 1 Region: 1-158
Classification Level Classification E-value
Superfamily EF-hand 3.68e-43
Family Calmodulin-like 0.0000000875
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000016707   Gene: ENSOGAG00000024831   Transcript: ENSOGAT00000027235
Sequence length 160
Comment pep:novel scaffold:OtoGar3:GL873606.1:7161801:7166593:-1 gene:ENSOGAG00000024831 transcript:ENSOGAT00000027235 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YKGFIKDCPSGQLDAAGFQKIYKQFFPFGDPTKFATFVFNVFDENKDGRIEFSEFIQALS
VTSRGTLDEKLRWAFKLYDLDNDGYITRNEMLDIVDAIYQMVGNTVELPEEENTPEKRVD
RIFAMMDKNADGKLTLQEFQEGSKADPSIVQALSLYDGLV
Download sequence
Identical sequences A0A091H5H0 D2H171 F1MZQ0 F1PET6 F6WGJ6 G1N134 G9KCV0 H0XKR7 L5K7C3
9615.ENSCAFP00000029561 9823.ENSSSCP00000006103 9823.ENSSSCP00000006105 ENSPVAP00000003345 ENSSSCP00000006105 ENSBTAP00000011496 ENSOGAP00000016707 XP_010135997.1.100080 ENSSSCP00000006105 ENSPVAP00000003345 ENSBTAP00000011496 ENSCAFP00000029561 ENSMGAP00000005178 ENSOGAP00000016707 ENSMGAP00000005178 ENSCAFP00000029561 ENSCJAP00000037900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]