SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000018592 from Otolemur garnettii 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000018592
Domain Number 1 Region: 188-411
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.83e-54
Family Voltage-gated potassium channels 0.00086
Further Details:      
 
Domain Number 2 Region: 15-129
Classification Level Classification E-value
Superfamily POZ domain 7.46e-33
Family Tetramerization domain of potassium channels 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000018592   Gene: ENSOGAG00000007336   Transcript: ENSOGAT00000007338
Sequence length 490
Comment pep:novel scaffold:OtoGar3:GL873541.1:9568292:9606455:1 gene:ENSOGAG00000007336 transcript:ENSOGAT00000007338 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVFGEFFHHPGQDEELVNLNVGGFKQSVDQSTLLRFPHTRLGKLLTCRSEEAILELCDDY
SVADKEYYFDRNPSLFRYVLNFYYTGKLHVMEELCVFSFCQEIEYWGINELFIDSCCSNR
YQERKEESHEKDWDQKSHDASTDSSFEESSLFEKELEKFDKKRFGQLRKKIWIRMENPAY
CLSAKLIAISSLSVVLASIVAMCIHSMSEFQNEDGEVDDPVLEGVEIACIAWFTGELAIR
LVAAPCQKKFWKNPLNIIDFVSIIPFYATLAVDTKEDESEDIENMGKVVQILRLMRIFRI
LKLARHSVGLRSLGATLRHSYHEVGLLLLFLSVGISIFSVLIYSVEKDDHTSSLTSIPIC
WWWATISMTTVGYGDTHPVTLAGKLIASTCIICGILVVALPITIIFNKFSKYYQKQKDID
VDQCSEDPPEKCHELPYFNIRDIYAQRVHAFISSLSSVGIVVSEPDSTDASSIEDKDVPH
ATSLENCTAK
Download sequence
Identical sequences H0XR50
ENSOGAP00000018592 ENSOGAP00000018592 XP_003787459.1.62490 XP_012659185.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]