SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000020868 from Otolemur garnettii 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000020868
Domain Number 1 Region: 172-305
Classification Level Classification E-value
Superfamily PH domain-like 5.99e-40
Family Pleckstrin-homology domain (PH domain) 0.000000781
Further Details:      
 
Domain Number 2 Region: 386-498
Classification Level Classification E-value
Superfamily SH2 domain 2.42e-24
Family SH2 domain 0.00000625
Further Details:      
 
Domain Number 3 Region: 19-79
Classification Level Classification E-value
Superfamily Phenylalanine zipper 1.44e-22
Family Adapter protein APS, dimerisation domain 0.0000218
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000020868   Gene: ENSOGAG00000025425   Transcript: ENSOGAT00000025866
Sequence length 625
Comment pep:novel scaffold:OtoGar3:GL873596.1:1035024:1046383:1 gene:ENSOGAG00000025425 transcript:ENSOGAT00000025866 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGATPGPATAAPVPVPVPDWRQFCELHAQAAAVDFAHKFCRFLRDNPAYDTPDAGASFS
RHFTTNFLDVFGEEVRRMLVARRADAMESEQGETPALKAAAYGHSRSSEDVSAHTATKAR
VRKGFSLRNMSLCVVDGVRDMWHRRASPELDGGTAPRAAEPPAEPRDKWMRRLRLTRTLA
AKVELVDIQREGALRFMVADDAAAGPGGTAQWQKCRLLLRRAVAGERFRLEFFVPPKASK
PKVSIPLSAIIEVRTTMPLEMPEKDNTFVLKVENGAEYILETIDSLQKHSWVADIQGCVD
PGDSEEDGELSCARGGCLASQVTSCSCELLTDAELPRPPETTAAMGAVVTAPHSRARDAV
GESLIHVPLETFLQTLESPGGSGSDSNNTGEEGAEPDPEVEPEPELSDYPWFHGTLSRVK
AAQLVLAGGPRSHGLFVIRQSETRPGEYVLTFNFQGKAKHLRLSLNGHGQCHVQHLWFQS
VLDMLRHFHTHPIPLESGGSADITLRSYVRAQGPPPEPGPTPNAAPAAPACWSEPAGQHY
FASLAAAVCPPASPSDATAASSSSASSSSAASGPAPPRPADGPLSARGRSDSADRLLEAV
AGGPEESPEAAGGRARAVENQYSFY
Download sequence
Identical sequences H0XXM5
ENSOGAP00000020868 ENSOGAP00000020868

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]