SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000021536 from Otolemur garnettii 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000021536
Domain Number 1 Region: 903-1098
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.14e-56
Family BCR-homology GTPase activation domain (BH-domain) 0.0000335
Further Details:      
 
Domain Number 2 Region: 692-824
Classification Level Classification E-value
Superfamily PH domain-like 5.32e-25
Family Pleckstrin-homology domain (PH domain) 0.0000364
Further Details:      
 
Domain Number 3 Region: 20-158
Classification Level Classification E-value
Superfamily PDZ domain-like 9.86e-20
Family PDZ domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000021536   Gene: ENSOGAG00000030856   Transcript: ENSOGAT00000026278
Sequence length 1499
Comment pep:novel scaffold:OtoGar3:GL873537.1:25417953:25468532:-1 gene:ENSOGAG00000030856 transcript:ENSOGAT00000026278 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VEGAEGMSLDLPLMPESLPRPPELPLGPRDGCSPRRTLPWQGPRTLLLHKSLQDGFGFTL
RHFIVYPPESAVHCSLKEEENGGRGGGPSPRPRLEPMDTIFVKNVKDAGPAHRAGLRTGD
RLVKVNGESVIGKTYSQVIALIQNSDDTLELSIMPKDEDILQLAYSQDAYLKGNEPYSGE
VRSIPEPPPICYPRKTYAPPARVSTWATMVPEPVSALPSDPRSPTAWSDPGPRVPSATRA
HLDNSSLGMSQPRPSPGAFPHLPSEPRMPRAFPEPGSRVPPSRLECQQALSHWLSNQVPR
RAGERRCPAMPPRARSASQDRLEDVTAHRPWPCSTSQDALSQLGWEGWHRARSDDYLSRV
TRSAEALGPGALVSPRFERCGWASQRPSVRTSACPPRDLPGPQGPPAAGLQGLDDIGYIG
YRSYSPSFQRRTGLLHALSFRDSPFGGLPTFNLAQSPAPFPPEAAEPPRVVRPESSTRAL
EPPSEDRRDEVVLRQKPPTGRKIQLTPARQMNLGLGDESPEPEASGRGERPGRKVAPLAT
TEDSLASIPFIDEPTSPSIDLQAKHVPASAVVSSAMNSAPVLGTSPSSPTFTFALGRHYS
QDCSSIKAGRRSSYLLAITTERSKSCDDGLNTFRDEGRALRRLPDRVPSLRMLRSFFTDG
SLDSWGTSEDADAPSKRHSTSDLSDATFSDIRREGWLYYKQILTKKGKKAGSGLRQWKRV
YAALRARSLSLSKERREPGPAAGAAAAGAGEDEAAPVCIGSCLVDISYSETKRRHVFRLT
TADFCEYLFQAEDRDDMLGWIRAIRENSRAEGEDPGCANQALISKKLNDYRKVSHSSGPK
ADSSPKGSRGLGGLKSEFLKQSAVRGFRTQDQPAGSKDDSAAAPKTPWSINIIKKNKKAA
PRAFGVRLEECQPATENQRVPLIVAACCRIVEARGLESTGIYRVPGNNAVVSSLQEQLNR
GPGDINLQDERWQDLNVISSLLKSFFRKLPEPLFTDDKYNDFIEANRIEDSRERMKTLRK
LIRDLPGHYYETLKFLVGHLKTIADHSEKNKMEPRNLALVFGPTLVRTSEDNMTDMVTHM
PDRYKIVETLIQHSDWFFSDEEDKGERTPVDDKEPQSVPNIEYLLPNIGRTVPPGDPGSA
TDSTTCSSAKSKGSWAPKKELYAREMLAISFISAVNRKRKKRREARGLGSSTDDDSEQEA
HKPGAGAPAPGPQGQPEGQLPGAAAPEAPGRLSPPAAPEERPAADTRSIVSGYSTLSTMD
RSECSGAGGRRAGAGDEADDERSELSHVETDTEGGAAGAGPGGRLARRPSFTSHHLIPCD
TLARRRLSRSRPDGEGAGTGRGGPRAAELPGSASSSSQESLRPPAAAATALGSRPSRIEA
LRLRLRGTADDMAVRLRRPLSPETRRRRSSWRRHTVVVQSPLTDLNFNEWKELGGGGTLE
PTGARAHSDNKDSGLSSLESTKARATSSAASLPAASGDPGALQSQPLRRSATSRLHQCL
Download sequence
Identical sequences H0XZJ3
ENSOGAP00000021536 ENSOGAP00000021536

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]