SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000021560 from Otolemur garnettii 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000021560
Domain Number 1 Region: 128-317
Classification Level Classification E-value
Superfamily PH domain-like 2.32e-63
Family Phosphotyrosine-binding domain (PTB) 0.0000000065
Further Details:      
 
Domain Number 2 Region: 464-570
Classification Level Classification E-value
Superfamily SH2 domain 4.85e-28
Family SH2 domain 0.0000018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000021560   Gene: ENSOGAG00000034363   Transcript: ENSOGAT00000035031
Sequence length 577
Comment pep:novel scaffold:OtoGar3:GL873610.1:5165981:5173246:1 gene:ENSOGAG00000034363 transcript:ENSOGAT00000035031 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLLPPKPKYNPLRNESLSSLEEGASGSTPPEELPSPSASSLGPILPPLPGDDSPTTLCS
FFPRMSGLKLASPAGGRLGPKGEPGRAAEDGEGIVGTAVPDSGSLPLLQDMNKLSGGGGR
RTRVEGGQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGVSYLVRYMGCVEVLQSMRALD
FNTRTQVTREAISLVCEAVPGAKGTTRRRKPCSRPLSSVLGRSNLKFAGMPITLTVSTSS
LNLMATDCKQIIANHHMQSISFASGGDPDTAEYVAYVAKDPVNQRACHILECPEGLAQDV
ISTIGQAFELRFKQYLRNPPKLVTPHDRMAGFDGSAWDEEEEEPPDHQYYNDFPGKEPPL
GGVVDMRLREGAAPGATRSTPPTAQTPSHLGATLPVGGDPEVRKQLPPPPPCPGRELFDD
PSYVNVQNLDKARQAGAGPPNPAINGSAPRDLFDMKPFEDALRVPPPPQLVSMAEQLRGE
PWFHGKLSRREAEALLQLNGDFLVRESTTTPGQYVLTGLQSGQPKHLLLVDPEGVVRTKD
HRFESVSHLISYHMDNHLPIISAGSELCLQQPVERKL
Download sequence
Identical sequences H0XZL7
ENSOGAP00000021560 ENSOGAP00000021560 XP_003795374.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]