SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000000162 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000000162
Domain Number 1 Region: 755-968
Classification Level Classification E-value
Superfamily ADP-ribosylation 1.44e-78
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.00000000219
Further Details:      
 
Domain Number 2 Region: 620-756
Classification Level Classification E-value
Superfamily Domain of poly(ADP-ribose) polymerase 8.76e-49
Family Domain of poly(ADP-ribose) polymerase 0.000000161
Further Details:      
 
Domain Number 3 Region: 478-601
Classification Level Classification E-value
Superfamily WGR domain-like 1.2e-41
Family WGR domain 0.000000202
Further Details:      
 
Domain Number 4 Region: 69-174
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.41e-31
Family PARP-type zinc finger 0.0072
Further Details:      
 
Domain Number 5 Region: 345-423
Classification Level Classification E-value
Superfamily BRCT domain 0.000000000294
Family DNA ligase 0.0067
Further Details:      
 
Domain Number 6 Region: 3-59
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000456
Family PARP-type zinc finger 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000000162   Gene: ENSPPYG00000000164   Transcript: ENSPPYT00000000176
Sequence length 972
Comment pep:known chromosome:PPYG2:1:23241821:23284882:1 gene:ENSPPYG00000000164 transcript:ENSPPYT00000000176 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFDGKVPHWYHFSCFWKVGHSIRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQDGI
GSKAEKTLGDFAAEYAKSNRSTCKGCMEKIEKGQVRLSKKMLDPEKPQLGMIDRWYHPGC
FVKNREELGFRPEYSASQLKGFSLLATEDKEALKKQLPGVKSEGKRKGDEVDGVDEVAKK
KSKKEKDKDSKLEKALKAQNDLIWNIKDELKKVCSTNDLKELLIFNKQQVPSGESAILDR
VADGMVFGALLPCEECSGQLVFKSDAYYCTGDVTAWTKCMVKTQTPNRKEWVTPKEFREI
SYLKKLKVKKQDRIFPPETSAPVAATPPPSTASAPAAVNSSASADKPLSNMKILTLGKLS
RNKDEVKAMIEKLGGKLTGTANKASLCISTKKEVEKMNKKMEEVKEANIRVVSEDFLQDV
SASTKSLQELFLAHILSPWGAEVKAEPVEVVAPRGKSGAALSKKSKGQVKEEGINKSEKR
MKLTLKGGAAVDPDSGLEHSAHVLEKGGKVFSATLGLVDIVKGTNSYYKLQLLEDDKENR
YWIFRSWGRVGTVIGSNKLEQMPSKEDAIEHFMKLYEEKTGNAWHSKNFTKYPKKFYPLE
IDYGQDEEAVKKLTVNPGTKSKLPKPVQDLIKMIFDVESMKKAMVEYEIDLQKMPLGKLS
KRQIQAAYSILSEVQQAVSQGSSDSQILDLSNRFYTLIPHDFGMRKPPLLNNADSVQAKV
EMLDNLLDIEVAYSLLRGGSDDSSKDPIDVNYEKLKTDIKVVDRDSEEAEIIRKYVKNTH
ATTHNAYDLEVIDIFKIEREGECQRYKPFKQLHNRRLLWHGSRTTNFAGILSQGLRIAPP
EAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLP
KGKHSVKGLGKTTPDPSASISLDGVEVPLGTGISSGVNDTCLLYNEYIVYDIAQVNLKYL
LKLKFNFKTSLW
Download sequence
Identical sequences H2N3J1
XP_002809428.2.23681 ENSPPYP00000000162 ENSPPYP00000000162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]